| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | BAFF-R/BR3 (CT) |
| available sizes | 100 µg |
rabbit anti-BAFF-R (CT) BR3 polyclonal antibody 4238
$469.00
Antibody summary
- Rabbit polyclonal to BAFF-R (CT) BR3
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-BAFF-R (CT) BR3 polyclonal antibody 4238
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 2-5 ug/mL. Positive control: human, mouse, or rat spleen tissue lysates. Immunohistochemistry: use at 5 ug/mL. Positive control: human tonsil. |
| Immunogen Peptide corresponding to aa 169-183 at the C-terminus of human BAFF-R. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for one (1) year at 4°C or -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens TNFRSF13C BAFF receptor |
| Gene names TNFRSF13C |
| Keywords Membrane, Receptor, Transmembrane, Transmembrane helix |
| Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ ESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGD KDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAG PEQQ |
| UniProt accession: Q5H8V1 |
Data
 |
| Western blot analysis of BAFF Receptor in human (H), mouse (M), and rat (R) spleen tissue lysates with BAFF Receptor antibody at 5 µg/mL. |
 |
| Immunohistochemistry of BAFF-R in human spleen tissue with BAFF-R antibody at 5 µg/mL. |
 |
| Immunofluorescence of BAFF-R in human spleen tissue with BAFF-R antibody at 20 µg/mL.
Red: BAFF Receptor Antibody (4238) Blue: DAPI staining |
 |
| Immunohistochemistry of BAFF Receptor in human tonsil tissue with BAFF Receptor antibody at 5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-BAFF-R (CT) BR3 polyclonal antibody 4238 been validated for?
This antibody is suitable for ELISA, Western blot (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and immunofluorescence (IF). Recommended dilutions include 2-5 µg/mL for immunoblotting and 5 µg/mL for immunohistochemistry.
How should the rabbit anti-BAFF-R (CT) BR3 polyclonal antibody be stored to maintain stability?
The antibody should be stored at 4°C or -20°C and is stable for one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What species does the rabbit anti-BAFF-R (CT) BR3 polyclonal antibody react with, and what positive controls are recommended for validation?
This antibody reacts with human, mouse, and rat BAFF-R. Positive controls for immunoblotting include spleen tissue lysates from human, mouse, or rat. For immunohistochemistry, human tonsil and spleen tissues are recommended as positive controls.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.