Skip to content

rabbit anti-BAFF (CT) polyclonal antibody 4041

$445.00

Antibody summary

  • Rabbit polyclonal to BAFF (CT)
  • Suitable for: ELISA,WB,ICC,IF,IHC
  • Isotype: IgG
  • 100 µg
SKU: 4041parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

BAFF (CT)

available sizes

100 µg

rabbit anti-BAFF (CT) polyclonal antibody 4041

antibody
Tested applications
WB,IHC,IHC,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: use at 1ug/mL.

Immunocytochemistry: use at 1ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentration for their application.

Positive control: Whole cell lysate from HL60 cells.
Immunogen
Peptide corresponding to aa 254-269 at the C-terminus of human BAFF.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens TNFSF13B
Tumor necrosis factor ligand superfamily member 13B
Protein names
Tumor necrosis factor ligand superfamily member 13B
Alternative names
B lymphocyte stimulator, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1
Gene names
TNFSF13B
Protein family
Belongs to the tumor necrosis factor family
Function
Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response
Subcellular location
Secreted
Structure
Homotrimer. Isoform 2 heteromultimerizes with isoform 1, probably limiting the amount of functional isoform 1 on the cell surface. Isoform 3 is unlikely form trimers or bind to BAFF receptors
Post-translational modification
The soluble form derives from the membrane form by proteolytic processing
Isoform 2 is not efficiently shed from the membrane unlike isoform 1
N-glycosylated
Keywords
3D-structure, Alternative splicing, Cell membrane, Cleavage on pair of basic residues, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Immunity, Membrane, Proteomics identification, Reference proteome, Secreted, Signal-anchor, Transmembrane, Transmembrane helix
Sequence
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP GEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
UniProt accession: Q9Y275

Data

benchmark-antibodies_anti-baff_ct_antibody_4041_1.jpg
Western Blot Validation in Human HL60 Cell Lysate (H) and Mouse Spleen Lysate (M)
Loading: 15 µg of lysates per lane. Antibodies: BAFF 4041 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-baff_ct_antibody_4041_2.gif
Western Blot Validation in Human, Mouse and Rat Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: BAFF 4041 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-baff_ct_antibody_4041_3.gif
Western Blot Validation with Recombinant Protein
Loading: 30 ng of human BAFF recombinant protein per lane. Antibodies: BAFF 4041 (Lane 1: 0.25 µg/mL; Lane 2: 0.5 µg/mL and Lane 3: 1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.Observed at around 18kD.
benchmark-antibodies_anti-baff_ct_antibody_4041_4.jpg
Immunocytochemistry Validation of BAFF in HL60 Cells
Immunocytochemical analysis of HL60 cells using anti-BAFF antibody (4041) at 1 µg/mL. Cells was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-baff_ct_antibody_4041_5.gif
Immunofluorescence Validation of BAFF in Human Spleen Tissue
Immunofluorescent analysis of 4% paraformaldehyde-fixed human spleen tissue labeling BAFF with 4041 at 20 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (green) and DAPI staining (blue).
benchmark-antibodies_anti-baff_ct_antibody_4041_6.gif
Regulated Expression Validation of BAFF in Myeloma Patients (Tai et al., 2006)
Immunoblot analysis was performed to monitor protein expression of BAFF with anti-BAFF antibodies in multiple myeloma cells with or without BMSCs. BAFF expression in cocultures at 8hr or 24hr was up-regulated by ~3.5-fold relative to BMSCs alone.
benchmark-antibodies_anti-baff_ct_antibody_4041_7.gif
Immunohistochemistry Validation of BAFF in Thyroid of Patients with Graves Diseases (Campi et al., 2015)
BAFF expression detected by anti-BAFF antibodies (4041) was remarkably increased in thyrocytes from multinodular goiter (-) compared with either Hashimoto's thyroiditis (-) or Graves' disease (-) while no staining was found in normal thyroid tissue (-).
benchmark-antibodies_anti-baff_ct_antibody_4041_8.gif
Immunohistochemistry Validation of BAFF in Murine Cardiac Transplants at Rejection (Ye et al., 2004)
BAFF expression detected by anti-BAFF antibodies (4041) was upregulated in intragraft leukocytes due to rejection at 7 days after heart transplant.

FAQ & Publications

Frequently Asked Questions
What species reactivity does the rabbit anti-BAFF (CT) polyclonal antibody 4041 exhibit?
This antibody is reactive to human BAFF (CT) and has been validated using human, mouse, and rat cell lines.
Which applications are recommended for use with the rabbit anti-BAFF (CT) polyclonal antibody 4041?
The antibody is suitable for ELISA, Western Blot (WB), Immunocytochemistry/Immunofluorescence (ICC/IF), and Immunohistochemistry (IHC). Recommended dilutions are typically 1 µg/mL for immunoblotting and immunocytochemistry.
How should the rabbit anti-BAFF (CT) polyclonal antibody 4041 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles.
What is the immunogen used to generate the rabbit anti-BAFF (CT) polyclonal antibody 4041?
The immunogen is a peptide corresponding to amino acids 254-269 at the C-terminus of human BAFF.
Which secondary antibodies are compatible with the rabbit anti-BAFF (CT) polyclonal antibody 4041 for detection?
Compatible secondary antibodies include goat anti-rabbit IgG H&L chain specific polyclonal antibodies conjugated to peroxidase, biotin, or FITC, including cross-absorbed versions for enhanced specificity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.