Skip to content

rabbit anti-BAD (Phospho-Ser112) polyclonal antibody 7191

$366.00

Antibody summary

  • Rabbit polyclonal to BAD (Phospho-Ser112)
  • Suitable for: WB,IHC
  • Isotype: Whole IgG
  • 100 µl
SKU: 7191parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

BAD (Phospho-Ser112)

available sizes

100 µL

rabbit anti-BAD (Phospho-Ser112) polyclonal antibody 7191

antibody
Tested applications
WB,IHC,IHC
Recommended dilutions
Immunoblotting: use at dilution of 1:500- 1:1,000. A ban of ~23kDa is detected.

Immunohistochemistry: use at dilution of 1:50- 1:100.

These are recommended working dilutions.

End user should determine optimal dilutions for their application.
Immunogen
Peptide sequence that includes phosphorylation site of Serine 112 (H-S-S(p)-Y-P) derived from mouse BAD and conjugated to KLH.
Size and concentration
100µL and 1 mg/mL
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C.
Storage buffer
PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl,
Purity
affinity purified
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens BAD
Bcl2-associated agonist of cell death
Protein names
Bcl2-associated agonist of cell death
Alternative names
Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-xL/Bcl-2-associated death promoter, Bcl2 antagonist of cell death
Gene names
BAD
Protein family
Belongs to the Bcl-2 family
Function
Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (By similarity). Appears to act as a link between growth factor receptor signaling and the apoptotic pathways
Subcellular location
Mitochondrion outer membrane, Cytoplasm
Structure
Forms heterodimers with the anti-apoptotic proteins, Bcl-X(L), Bcl-2 and Bcl-W. Also binds protein S100A10 (By similarity). The Ser-75/Ser-99 phosphorylated form binds 14-3-3 proteins (By similarity). Interacts with AKT1 and PIM3. Interacts (via BH3 domain) with NOL3 (via CARD domain); preventing the association of BAD with BCL2 (By similarity). Interacts with HIF3A (via C-terminus domain); the interaction reduces the binding between BAD and BAX (By similarity). Interacts with GIMAP3/IAN4 and GIMAP5/IAN5 (PubMed:16509771)
Post-translational modification
Phosphorylated on one or more of Ser-75, Ser-99, Ser-118 and Ser-134 in response to survival stimuli, which blocks its pro-apoptotic activity. Phosphorylation on Ser-99 or Ser-75 promotes heterodimerization with 14-3-3 proteins. This interaction then facilitates the phosphorylation at Ser-118, a site within the BH3 motif, leading to the release of Bcl-X(L) and the promotion of cell survival. Ser-99 is the major site of AKT/PKB phosphorylation, Ser-118 the major site of protein kinase A (CAPK) phosphorylation. Phosphorylation at Ser-99 by PKB/AKT1 is almost completely blocked by the apoptotic C-terminus cleavage product of PKN2 generated by caspases-3 activity during apoptosis
Methylation at Arg-94 and Arg-96 by PRMT1 inhibits Akt-mediated phosphorylation at Ser-99
Keywords
3D-structure, Acetylation, Apoptosis, Cytoplasm, Membrane, Methylation, Mitochondrion, Mitochondrion outer membrane, Phosphoprotein, Proteomics identification, Reference proteome
Sequence
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
UniProt accession: Q92934

Data

No results found

FAQ & Publications

Frequently Asked Questions
What are the recommended dilutions for using the rabbit anti-BAD (Phospho-Ser112) polyclonal antibody in Western blot and immunohistochemistry?
For Western blot (WB), the recommended dilution range is 1:500 to 1:1,000, detecting a band of approximately 23 kDa. For immunohistochemistry (IHC), the suggested dilution range is 1:50 to 1:100. These are starting points, and optimal dilutions should be determined by the end user based on their specific application.
How should the rabbit anti-BAD (Phospho-Ser112) polyclonal antibody be stored to maintain stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is provided in a PBS buffer (without Mg2+ and Ca2+), pH 7.4, containing 150 mM NaCl.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.