| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | BAD (Phospho-Ser112) |
| available sizes | 100 µL |
rabbit anti-BAD (Phospho-Ser112) polyclonal antibody 7191
$366.00
Antibody summary
- Rabbit polyclonal to BAD (Phospho-Ser112)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-BAD (Phospho-Ser112) polyclonal antibody 7191
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500- 1:1,000. A ban of ~23kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their application. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 112 (H-S-S(p)-Y-P) derived from mouse BAD and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BAD Bcl2-associated agonist of cell death |
| Protein names Bcl2-associated agonist of cell death |
| Alternative names Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-xL/Bcl-2-associated death promoter, Bcl2 antagonist of cell death |
| Gene names BAD |
| Protein family Belongs to the Bcl-2 family |
| Function Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (By similarity). Appears to act as a link between growth factor receptor signaling and the apoptotic pathways |
| Subcellular location Mitochondrion outer membrane, Cytoplasm |
| Structure Forms heterodimers with the anti-apoptotic proteins, Bcl-X(L), Bcl-2 and Bcl-W. Also binds protein S100A10 (By similarity). The Ser-75/Ser-99 phosphorylated form binds 14-3-3 proteins (By similarity). Interacts with AKT1 and PIM3. Interacts (via BH3 domain) with NOL3 (via CARD domain); preventing the association of BAD with BCL2 (By similarity). Interacts with HIF3A (via C-terminus domain); the interaction reduces the binding between BAD and BAX (By similarity). Interacts with GIMAP3/IAN4 and GIMAP5/IAN5 (PubMed:16509771) |
| Post-translational modification Phosphorylated on one or more of Ser-75, Ser-99, Ser-118 and Ser-134 in response to survival stimuli, which blocks its pro-apoptotic activity. Phosphorylation on Ser-99 or Ser-75 promotes heterodimerization with 14-3-3 proteins. This interaction then facilitates the phosphorylation at Ser-118, a site within the BH3 motif, leading to the release of Bcl-X(L) and the promotion of cell survival. Ser-99 is the major site of AKT/PKB phosphorylation, Ser-118 the major site of protein kinase A (CAPK) phosphorylation. Phosphorylation at Ser-99 by PKB/AKT1 is almost completely blocked by the apoptotic C-terminus cleavage product of PKN2 generated by caspases-3 activity during apoptosis Methylation at Arg-94 and Arg-96 by PRMT1 inhibits Akt-mediated phosphorylation at Ser-99 |
| Keywords 3D-structure, Acetylation, Apoptosis, Cytoplasm, Membrane, Methylation, Mitochondrion, Mitochondrion outer membrane, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ |
| UniProt accession: Q92934 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What are the recommended dilutions for using the rabbit anti-BAD (Phospho-Ser112) polyclonal antibody in Western blot and immunohistochemistry?
For Western blot (WB), the recommended dilution range is 1:500 to 1:1,000, detecting a band of approximately 23 kDa. For immunohistochemistry (IHC), the suggested dilution range is 1:50 to 1:100. These are starting points, and optimal dilutions should be determined by the end user based on their specific application.
How should the rabbit anti-BAD (Phospho-Ser112) polyclonal antibody be stored to maintain stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is provided in a PBS buffer (without Mg2+ and Ca2+), pH 7.4, containing 150 mM NaCl.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.