| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ALIEN |
| available sizes | 100 µg |
rabbit anti-Alien polyclonal antibody 1874
$376.00
Antibody summary
- Rabbit polyclonal to Alien
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-Alien polyclonal antibody 1874
| target relevance |
|---|
| Homo sapiens COPS2 COP9 signalosome complex subunit 2 |
| Protein names COP9 signalosome complex subunit 2 |
| Alternative names Alien homolog, JAB1-containing signalosome subunit 2, Thyroid receptor-interacting protein 15 |
| Gene names COPS2 |
| Protein family Belongs to the CSN2 family |
| Function Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1 |
| Subcellular location Cytoplasm, Nucleus |
| Structure Component of the CSN complex, composed of COPS1/GPS1, COPS2, COPS3, COPS4, COPS5, COPS6, COPS7 (COPS7A or COPS7B), COPS8 and COPS9 isoform 1 (PubMed:11337588, PubMed:18850735, PubMed:26456823). In the complex, it probably interacts directly with COPS1, COPS4, COPS5, COPS6 and COPS7 (COPS7A or COPS7B) (PubMed:11337588, PubMed:18850735). Specifically interacts with the ligand binding domain of the thyroid receptor (TR). Does not require the presence of thyroid hormone for its interaction (By similarity). Interacts with CUL1 and CUL2 (PubMed:11337588). Interacts with IRF8/ICSBP1 and with nuclear receptors NR2F1 and NR0B1 (PubMed:10207062, PubMed:10713076, PubMed:10991940). Interacts with NIF3L1 (By similarity) |
| Post-translational modification Phosphorylated by CK2 and PKD kinases |
| Keywords 3D-structure, Alternative splicing, Cytoplasm, Direct protein sequencing, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Signalosome |
| Sequence MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL EGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS TSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQ TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIREC GGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLI KLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR YTALDKWTNQLNSLNQAVVSKLA |
| UniProt accession: P61201 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Alien polyclonal antibody 1874 been validated for?
This antibody is validated for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the rabbit anti-Alien polyclonal antibody 1874 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution range for using this antibody in immunoblotting experiments?
For immunoblotting, the recommended dilution is between 1:500 and 1:1,000. Under these conditions, the antibody detects a band of approximately 50 kDa.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.