| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Akirin 1 |
| available sizes | 100 µg |
rabbit anti-Akirin1 polyclonal antibody 3921
$445.00
Antibody summary
- Rabbit polyclonal to Akirin1
- Suitable for: ELISA,WB
- Isotype: IgG
- 100 µg
rabbit anti-Akirin1 polyclonal antibody 3921
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 2ug/mL Positive control: Rat liver lysate. |
| Immunogen Intermediate domain peptide sequence (14 amino acids) derived from human Akirin1 (GenBank accession no. CAI16710). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens AKIRIN1 Akirin-1 |
| Protein names Akirin-1 |
| Gene names AKIRIN1 |
| Protein family Belongs to the akirin family |
| Function Molecular adapter that acts as a bridge between proteins, and which is involved skeletal muscle development (By similarity). Functions as a signal transducer for MSTN during skeletal muscle regeneration and myogenesis (By similarity). May regulate chemotaxis of both macrophages and myoblasts by reorganising actin cytoskeleton, leading to more efficient lamellipodia formation via a PI3 kinase dependent pathway (By similarity). In contrast to AKIRIN2, not involved in nuclear import of proteasomes (PubMed:34711951) |
| Subcellular location Nucleus |
| Keywords Alternative splicing, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQ PAPPGSERRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSP GSSWMKKDQPTFTLRQVGIICERLLKDYEDKIREEYEQILNTKLAEQYESFVKFTHDQIM RRYGTRPTSYVS |
| UniProt accession: Q9H9L7 |
Data
 |
| Western blot analysis of Akirin1 in rat liver tissue lysate with Akirin1 antibody at (A) 1 and (B) 2 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Akirin1 polyclonal antibody 3921 been validated for?
This antibody has been tested and validated for use in Western blotting (WB) and enzyme-linked immunosorbent assay (ELISA). Recommended dilution for immunoblotting is 2 µg/mL using rat liver lysate as a positive control.
How should the rabbit anti-Akirin1 polyclonal antibody 3921 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-Akirin1 polyclonal antibody 3921?
The immunogen is a 14 amino acid peptide derived from the intermediate domain of human Akirin1, corresponding to the sequence from GenBank accession number CAI16710.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.