| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | AIF (IN) |
| available sizes | 100 µg |
rabbit anti-AIF (IN) polyclonal antibody 5823
$445.00
Antibody summary
- Rabbit polyclonal to AIF (IN)
- Suitable for: ELISA,WB,IHC-P
- Isotype: IgG
- 100 µg
rabbit anti-AIF (IN) polyclonal antibody 5823
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions Immunoblotting: use at 1-10ug/mL Immunohistochemistry: use at 10ug/mLImmunohistochemistry of AIF in human retina with AIF (IN) antibody at 10ug/mL. These are recommended concentrations. Endusers should determine optimal concentrations for their applications. Positive |
| Immunogen Peptide corresponding to aa 517- 531 of human AIF. This sequence is identical to those of mouse and rat AIF. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CNKSR1 Connector enhancer of kinase suppressor of ras 1 |
| Protein names Connector enhancer of kinase suppressor of ras 1 |
| Alternative names CNK homolog protein 1, Connector enhancer of KSR-like |
| Gene names CNKSR1 |
| Protein family Belongs to the CNKSR family |
| Function May function as an adapter protein or regulator of Ras signaling pathways |
| Subcellular location Cytoplasm, Membrane |
| Structure Interacts with RHO and RALGDS |
| Post-translational modification Phosphorylated on tyrosine |
| Keywords 3D-structure, Alternative splicing, Coiled coil, Cytoplasm, Membrane, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MEPVETWTPGKVATWLRGLDDSLQDYPFEDWQLPGKNLLQLCPQSLEALAVRSLGHQELI LGGVEQLQALSSRLQTENLQSLTEGLLGATHDFQSIVQGCLGDCAKTPIDVLCAAVELLH EADALLFWLSRYLFSHLNDFSACQEIRDLLEELSQVLHEDGPAAEKEGTVLRICSHVAGI CHNILVCCPKELLEQKAVLEQVQLDSPLGLEIHTTSNCQHFVSQVDTQVPTDSRLQIQPG DEVVQINEQVVVREERDMVGWPRKNMVRELLREPAGLSLVLKKIPIPETPPQTPPQVLDS PHQRSPSLSLAPLSPRAPSEDVFAFDLSSNPSPGPSPAWTDSASLGPEPLPIPPEPPAIL PAGVAGTPGLPESPDKSPVGRKKSKGLATRLSRRRVSCRELGRPDCDGWLLLRKAPGGFM GPRWRRRWFVLKGHTLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPF IFAADTLTDLSMWVRHLITCISKYQSPGRAPPPREEDCYSETEAEDPDDEAGSHSASPSP AQAGSPLHGDTSPAATPTQRSPRTSFGSLTDSSEEALEGMVRGLRQGGVSLLGQPQPLTQ EQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQVLEEVLGDPELTGEKFRQWKEQ NRELYSEGLGAWGVAQAEGSSHILTSDSTEQSPHSLPSDPEEHSHLCPLTSESSLRPPDL |
| UniProt accession: Q969H4 |
Data
 |
| Western Blot Validation in Different Species Loading: 15 µg of lysates per lane. Antibodies: AIF 5823, (1 µg /mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.Lane A: Human K562 cellsLane B: Rat heartLane C: Mouse heart |
 |
| Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines Loading: 15 µg of lysates per lane. Antibodies: AIF 5823, (1 µg/mL), AIF 2239, (1 µg/mL), AIF 2301, (2 µg/mL), and beta-actin (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Western Blot Validation in Human Cell Lines Loading: 15 µg of lysates per lane. Antibodies: AIF 5823, (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Western Blot Validation in Mouse and Rat Cell Lines Loading: 15 µg of lysates per lane. Antibodies: AIF 5823, (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution. |
 |
| Immunohistochemistry Validation of AIF in Human Retina Tissue Immunohistochemical analysis of paraffin-embedded human retina tissue using anti-AIF antibody (5823) at 10 µg/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin. |
 |
| KD and Induced Validation of AIF in H1299 Cells(Stambolsky et al., 2006) Western blot analysis of AIF knockdown with anti-AIF antibodies in H1299 cells. AIF expression was disrupted in AIF knockdown cells (siRNA1 and siRNA4). An increased expression of AIF was induced by ZnCl2 treatment, which was not observed in AIF knockdown cells. |
 |
| KD Validation of AIF in AIF Silenced Stable Cells(Apostolova et al., 2006) AIF silencing is sustained in stable cell lines. Western blot analysis ofstable lines AIF-1-10, AIF-2-4 and pU6-2 using anti-AIF antibodies. AIF protein was disrupted after AIF silencing with AIF siRNA (AIF-1-10 and AIF-2-4) as compared to control (Hep3B and pU6-2). |
 |
| Immunofluorescence Validation of AIF in HeLa Cells (Rossi et al., 2009) HeLa cells were transfected withMitofilin-specific (MITO-siRNA) or with nonspecific (NS-siRNA) siRNAs. AIF staining with anti-AIF antibodies was shown as a mitochondrial marker in the absence of Mitofilin. |
 |
| Immunofluorescence Validation of AIF in Rat Hippocampal Neurons (Hofer et al., 2011) (G-L) After exposure to bacterial components, AIF colocalized in mature neurons (MAP2; I, L), immature neurons (DcX;H, K), and stem/progenitor cells (Nestin; G, J). AIF expression was detected by anti-AIF antibodies. |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-AIF (IN) polyclonal antibody 5823 react with?
This antibody reacts with human, mouse, and rat AIF, as the immunogen peptide sequence is identical in these species.
Which applications has the rabbit anti-AIF (IN) polyclonal antibody 5823 been validated for?
The antibody is suitable and validated for ELISA, Western blotting (WB), immunohistochemistry on paraffin-embedded tissues (IHC-P), and immunocytochemistry/immunofluorescence (ICC/IF).
How should the rabbit anti-AIF (IN) polyclonal antibody 5823 be stored to maintain stability?
Store the antibody at -20°C to maintain stability for at least one year, and avoid multiple freeze-thaw cycles to preserve antibody integrity.
What are the recommended antibody concentrations for Western blot and immunohistochemistry using antibody 5823?
For Western blotting, use the antibody at 1-10 µg/mL, and for immunohistochemistry, a concentration of 10 µg/mL is recommended, though end users should optimize concentrations for their specific applications.
What is the host species and clonality of the anti-AIF antibody 5823?
This antibody is a rabbit-derived polyclonal antibody of the IgG isotype, purified by peptide affinity chromatography.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.