Immunohistochemistry (IHC) : Human brain hippocampus stained with anti-ubiquitin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of few neurons..

mouse anti-Ubiquitin monoclonal antibody (ZM191) 6399

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Ubiquitin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Brain
Visualization: Cytoplasmic and membranous
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6399parent Categories: antibody, Zeta IHC antibodies Tags: General & Epithelial Markers, Ubiquitin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Ubiquitin monoclonal antibody ZM191 6399

antibody
Database link: human P0CG47
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Brain
Immunogen Recombinant human Ubiquitin protein fragment (around aa 1-119)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens UBB Polyubiquitin-B
Protein names Polyubiquitin-B
Gene names UBB
Protein family Belongs to the ubiquitin family
Function Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in proteotoxic stress response and cell cycle; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling
Subcellular location Cytoplasm, Nucleus, Mitochondrion outer membrane
Structure Interacts with SKP1-KMD2A and SKP1-KMD2B complexes. Interacts with REV1 (PubMed:29778604)
Post-translational modification Phosphorylated at Ser-65 by PINK1 during mitophagy (PubMed:24660806, PubMed:24751536, PubMed:24784582, PubMed:25527291, PubMed:26161729). Phosphorylated ubiquitin specifically binds and activates parkin (PRKN), triggering mitophagy (PubMed:24660806, PubMed:24751536, PubMed:24784582, PubMed:25527291, PubMed:26161729). Phosphorylation does not affect E1-mediated E2 charging of ubiquitin but affects discharging of E2 enzymes to form polyubiquitin chains. It also affects deubiquitination by deubiquitinase enzymes such as USP30 (PubMed:25527291) Mono-ADP-ribosylated at the C-terminus by PARP9, a component of the PPAR9-DTX3L complex. ADP-ribosylation requires processing by E1 and E2 enzymes and prevents ubiquitin conjugation to substrates such as histones (Microbial infection) Mono-ADP-ribosylated at Thr-66 by the C.violaceum CteC virulence factor. ADP-ribosylation causes the shutdown of polyubiquitin synthesis and disrupts the recognition and reversal of polyubiquitin
Keywords 3D-structure, ADP-ribosylation, Cytoplasm, Direct protein sequencing, Isopeptide bond, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus, Phosphoprotein, Reference proteome, Repeat, Ubl conjugation
Sequence MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
UniProt accession: P0CG47

Data

Human brain hippocampus stained with anti-ubiquitin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of few neurons..

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Ubiquitin monoclonal antibody (ZM191) specifically react with?

This antibody specifically reacts with human Ubiquitin protein.

Which application is the mouse anti-Ubiquitin monoclonal antibody (ZM191) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-Ubiquitin monoclonal antibody (ZM191) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, store at -20°C while avoiding repeated freeze-thaw cycles.

What is the recommended dilution range for using the concentrated mouse anti-Ubiquitin monoclonal antibody (ZM191) in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

What is the immunogen used to generate the mouse anti-Ubiquitin monoclonal antibody (ZM191)?

The antibody was raised against a recombinant human Ubiquitin protein fragment encompassing approximately amino acids 1 to 119.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.