| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | RbAp48 |
| available sizes | 100 µg |
mouse anti-RbAp48 monoclonal antibody (15G12) 2844
$503.00
Antibody summary
- Mouse monoclonal to RbAp48
- Suitable for: WB,ICC/IF,IHC-P,IP,EMSA
- Isotype: IgG2a
- 100 µg
mouse anti-RbAp48 monoclonal antibody (15G12) 2844
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at 1-5ug/mL. A band of ~48kDa is detected. Detection of RbAp48 in K562, THP-1, and HL-60 whole cell extracts (30ug), separated by 10% SDS-PAGE, with #3111 at 2ug/mL. These are recommended concentrations. Endusers should determine optimal concentrations for their |
| Immunogen GST fusion protein corresponding to aa 1-425 of human RbAp48. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable at -20°C for at least one (1) year; store in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens RB1 Retinoblastoma-associated protein |
| Protein names Retinoblastoma-associated protein |
| Alternative names p105-Rb, p110-RB1, pRb, pp110 |
| Gene names RB1 |
| Protein family Belongs to the retinoblastoma protein (RB) family |
| Function Tumor suppressor that is a key regulator of the G1/S transition of the cell cycle (PubMed:10499802). The hypophosphorylated form binds transcription regulators of the E2F family, preventing transcription of E2F-responsive genes (PubMed:10499802). Both physically blocks E2Fs transactivating domain and recruits chromatin-modifying enzymes that actively repress transcription (PubMed:10499802). Cyclin and CDK-dependent phosphorylation of RB1 induces its dissociation from E2Fs, thereby activating transcription of E2F responsive genes and triggering entry into S phase (PubMed:10499802). RB1 also promotes the G0-G1 transition upon phosphorylation and activation by CDK3/cyclin-C (PubMed:15084261). Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, KMT5B and KMT5C, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. Mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex (By similarity) |
| Subcellular location Nucleus, Cytoplasm |
| Structure (Microbial infection) Interacts with molluscum contagiosum virus protein MC007 |
| Post-translational modification Phosphorylated by CDK6 and CDK4, and subsequently by CDK2 at Ser-567 in G1, thereby releasing E2F1 which is then able to activate cell growth. Dephosphorylated at the late M phase. SV40 large T antigen, HPV E7 and adenovirus E1A bind to the underphosphorylated, active form of pRb. Phosphorylation at Thr-821 and Thr-826 promotes interaction between the C-terminal domain C and the Pocket domain, and thereby inhibits interactions with heterodimeric E2F/DP transcription factor complexes. Dephosphorylated at Ser-795 by calcineruin upon calcium stimulation. CDK3/cyclin-C-mediated phosphorylation at Ser-807 and Ser-811 is required for G0-G1 transition. Phosphorylated by CDK1 and CDK2 upon TGFB1-mediated apoptosis N-terminus is methylated by METTL11A/NTM1 (By similarity). Monomethylation at Lys-810 by SMYD2 enhances phosphorylation at Ser-807 and Ser-811, and promotes cell cycle progression. Monomethylation at Lys-860 by SMYD2 promotes interaction with L3MBTL1 Acetylated during keratinocyte differentiation. Acetylation at Lys-873 and Lys-874 regulates subcellular localization. Can be deacetylated by SIRT1 |
| Involvement in disease Childhood cancer retinoblastoma Congenital malignant tumor that arises from the nuclear layers of the retina. It occurs in about 1:20'000 live births and represents about 2% of childhood malignancies. It is bilateral in about 30% of cases. Although most RB appear sporadically, about 20% are transmitted as an autosomal dominant trait with incomplete penetrance. The diagnosis is usually made before the age of 2 years when strabismus or a gray to yellow reflex from pupil ('cat eye') is investigated. Bladder cancer A malignancy originating in tissues of the urinary bladder. It often presents with multiple tumors appearing at different times and at different sites in the bladder. Most bladder cancers are transitional cell carcinomas that begin in cells that normally make up the inner lining of the bladder. Other types of bladder cancer include squamous cell carcinoma (cancer that begins in thin, flat cells) and adenocarcinoma (cancer that begins in cells that make and release mucus and other fluids). Bladder cancer is a complex disorder with both genetic and environmental influences. Osteogenic sarcoma A sarcoma originating in bone-forming cells, affecting the ends of long bones. |
| Keywords 3D-structure, Acetylation, Cell cycle, Chromatin regulator, Cytoplasm, Direct protein sequencing, Disease variant, DNA-binding, Host-virus interaction, Methylation, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation, Tumor suppressor |
| Sequence MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK LAEMTSTRTRMQKQKMNDSMDTSNKEEK |
| UniProt accession: P06400 |
Data
 |
| Immunohistochemical analysis of paraffin-embedded H1299 xenograft, using RbAp48 + RbAp46(2844) antibody at 1:200 dilution. |
 |
| Immunohistochemical analysis of paraffin-embedded C2C12 xenograft, using RbAp48 + RbAp46(2844) antibody at 1:200 dilution. |
 |
| RbAp48 + RbAp46 antibody [15G12] detects RbAp48 + RbAp46 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: RbAp48 + RbAp46 stained by RbAp48 + RbAp46 antibody [15G12] (2844) diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:100. |
 |
| RbAp48 + RbAp46 antibody [15G12] detects RbAp48 + RbAp46 protein at nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human cervical carcinoma.RbAp48 + RbAp46 stained by RbAp48 + RbAp46 antibody [15G12] (2844) diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min |
 |
| Various whole cell extracts (30 µg) were separated by 10% SDS-PAGE, and the membrane was blotted with RbAp48 + RbAp46 antibody [15G12] (2844) diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced. |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-RbAp48 monoclonal antibody (15G12) been validated for?
This antibody has been tested and is suitable for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), immunohistochemistry on paraffin-embedded sections (IHC-P), immunoprecipitation (IP), and electrophoretic mobility shift assay (EMSA). Recommended dilutions for immunoblotting are 1-5 µg/mL.
What is the host species and clonality of the anti-RbAp48 antibody?
The antibody is a mouse monoclonal with an IgG2a isotype.
How should the mouse anti-RbAp48 monoclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C in appropriate aliquots to avoid multiple freeze-thaw cycles. Under these conditions, it is stable for at least one year.
What is the immunogen used to generate the mouse anti-RbAp48 monoclonal antibody (15G12)?
The immunogen is a GST fusion protein corresponding to amino acids 1-425 of the human RbAp48 protein.
Which secondary antibodies are compatible with this mouse anti-RbAp48 monoclonal antibody?
Compatible secondary antibodies include goat anti-mouse IgG H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC. Some available secondary antibodies are cross-adsorbed to reduce cross-reactivity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.