mouse anti-NeuN monoclonal antibody (2Q158) 9018

Price range: $100.00 through $2,600.00

Antibody summary

Mouse monoclonal to NeuN
Suitable for: WB, ICC/IF, IHC
Reacts with: human, mouse, rat, rabbit
Isotype: IgG1
100 µg, 25 µg, 1 mg

available sizes

Clear

SKU: 9018parent Categories: antibody, cell marker Tag: NeuN

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	1 mg, 100 µg, 25 µg

mouse anti-NeuN monoclonal antibody (2Q158) 9018

antibody
Database link: human A6NFN3 mouse Q8BIF2
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:500-1:1000 IF/IHC 1:5000-1:10000
Immunogen Purified cell nuclei from mouse brain
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 0.1% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal - Isotype Control

target relevance
Homo sapiens RBFOX3 RNA binding protein fox-1 homolog 3
Protein names RNA binding protein fox-1 homolog 3
Alternative names Fox-1 homolog C, Neuronal nuclei antigen
Gene names RBFOX3
Function Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD)
Subcellular location Nucleus, Cytoplasm
Keywords Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Proteomics identification, Reference proteome, RNA-binding
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFG QFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTN KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA APPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHT IGPAATYSIGTM
UniProt accession: A6NFN3

Data

https://benchmarkantibodies.com/wp-content/uploads/2024/04/9018_1.webp

IHC-P analysis of rat cerebellum tissue using NeuN antibody.Immunoreactivity is seen as nuclear staining in the neurons in the granular layer. Antigen retireval : Citrate Buffer, pH 6.0 Dilution : 1:100

https://benchmarkantibodies.com/wp-content/uploads/2024/04/9018_2.webp

IHC-P analysis of mouse brain tissue (dentate gyrus and subventricular zone) using NeuN antibody. Red : Primary antibody Green : BrdU

https://benchmarkantibodies.com/wp-content/uploads/2024/04/9018_3.webp

IHC-P analysis of mouse brain tissue (dentate gyrus and subventricular zone) using NeuN antibody.Red : Primary antibody Green : BrdU Antigen retireval : Citrate Buffer, pH 6.0

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-NeuN monoclonal antibody (2Q158) 9018 react with?

This antibody reacts with human, mouse, rat, and rabbit species.

What are the recommended applications and dilutions for using this NeuN antibody?

The antibody is suitable for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC). Recommended dilutions are 1:500 to 1:1000 for WB, and 1:5000 to 1:10000 for ICC/IF and IHC.

How should the mouse anti-NeuN monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be stored at -20°C, avoiding freeze-thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.