Immunohistochemistry (IHC) : Human breast carcinoma stained with anti-Mammaglobin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor glands.

mouse anti-Mammaglobin monoclonal antibody (304-1A5) 6246

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Mammaglobin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Normal or neoplastic breast tissue
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6246parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, Mammaglobin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Mammaglobin monoclonal antibody 304-1A5 6246

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Normal or neoplastic breast tissue
Immunogen Recombinant full-length protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens SCGB2A2 Mammaglobin-A
Protein names Mammaglobin-A
Alternative names Mammaglobin-1, Secretoglobin family 2A member 2
Gene names SCGB2A2
Protein family Belongs to the secretoglobin family. Lipophilin subfamily
Subcellular location Secreted
Keywords Alternative splicing, Glycoprotein, Proteomics identification, Reference proteome, Secreted, Signal
Sequence MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAID ELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
UniProt accession: Q13296

Data

Human breast carcinoma stained with anti-Mammaglobin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor glands.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Mammaglobin monoclonal antibody (304-1A5) suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-Mammaglobin antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid freeze/thaw cycles.

Which species does the mouse anti-Mammaglobin monoclonal antibody react with?

The antibody specifically reacts with human mammaglobin protein.

What is the recommended dilution for using the concentrated mouse anti-Mammaglobin antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is 1:100.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.