mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 2

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 3

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 4

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 5

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 6

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022 - Image 7

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022

$409.00

Antibody summary

Mouse monoclonal to LAMP1
Suitable for: WB, ICC/IF, IHC
Reacts with: human
Isotype: IgG1
100 µg

SKU: 9022 Categories: antibody, cell marker Tag: LAMP1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	100 µg

mouse anti-LAMP1 monoclonal antibody (H4A3) 9022

antibody
Database link: human P11279
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:10000 IF/ICC and IHC: 1:2000
Immunogen Amino acids 32-350 of the human LAMP1 precursor sequence in NP_005552.3 purified from E. coli
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG1 - Isotype Control

target relevance
Homo sapiens LAMP1 Lysosome-associated membrane glycoprotein 1
Protein names Lysosome-associated membrane glycoprotein 1
Alternative names CD107 antigen-like family member A
Gene names LAMP1
Protein family Belongs to the LAMP family
Function Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation, autophagy and cholesterol homeostasis (PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as a direct inhibitor of the proton channel TMEM175, facilitating lysosomal acidification for optimal hydrolase activity (PubMed:37390818). Also plays an important role in NK-cells cytotoxicity (PubMed:2022921, PubMed:23632890). Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule (PubMed:23632890). In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content (PubMed:23847195). Presents carbohydrate ligands to selectins (PubMed:7685349)
Subcellular location Lysosome membrane, Endosome membrane, Late endosome membrane, Cell membrane, Cytolytic granule membrane
Structure (Microbial infection) Interacts with mumps virus protein F; this interaction promotes protein F cleavage by FURIN
Post-translational modification O- and N-glycosylated; some of the 18 N-linked glycans are polylactosaminoglycans (Microbial infection) The glycosylation of Asn-76 is essential for Lassa virus entry into cells
Keywords 3D-structure, Alternative splicing, Cell membrane, Direct protein sequencing, Disulfide bond, Endosome, Glycoprotein, Host cell receptor for virus entry, Host-virus interaction, Lysosome, Membrane, Proteomics identification, Receptor, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI
UniProt accession: P11279

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-1.jpg

LAMP-1 Antibody (H4A3) Alexa Fluor® 546:AF546. Direct fluorescent western blot analysis of LAMP-1 expression in U-937 (A) and ECV304 (B) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-2.jpg

LAMP-1 Antibody (H4A3): Western blot analysis of LAMP-1 expression in HeLa (A), JAR (B), ECV304 (C), U-937 (D), Jurkat (E) and Ramos (F) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-3.jpg

LAMP-1 Antibody (H4A3): Immunoperoxidase staining of formalin fixed, paraffin-embedded human esophagus tissue showing cytoplasmic staining of squamous epithelial cells.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-5.jpg

LAMP-1 Antibody (H4A3): Near-infrared western blot analysis of LAMP-1 expression in MDA-MB-231 (A), K-562 (B), HT-1080 (C) and JAR (D) whole cell lysates. Detection reagent used: m-IgGκ BP-CFL 680.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-6.jpg

LAMP-1 Antibody (H4A3): Near-infrared western blot analysis of LAMP-1 expression in MDA-MB-231 (A), K-562 (B), HT-1080 (C) and JAR (D) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-7.jpg

LAMP-1 Antibody (H4A3) Alexa Fluor® 488. Direct fluorescent western blot analysis of LAMP-1 expression in U-937 (A), ECV304 (B) and Jurkat (C) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-8.jpg

Simultaneous direct near-infrared western blot analysis of LAMP-1 expression, detected with LAMP-1 Antibody (H4A3) Alexa Fluor® 680: AF680 and β-Actin expression, detected with β-Actin (C4) Alexa Fluor® 790: AF790 in HT-1080 (A) and HeLa (B) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-9.jpg

LAMP-1 Antibody (H4A3) PE. FCM analysis of JAR cells. Black line histogram represents the isotype control, normal mouse IgG1.

benchmarkantibodies.com/wp-content/uploads/2024/03/9022-10.jpg

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-LAMP1 monoclonal antibody (H4A3) suitable for, and what are the recommended dilutions?

This antibody is suitable for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC). The recommended dilution is 1:10,000 for Western blot and 1:2,000 for ICC/IF and IHC.

How should the mouse anti-LAMP1 monoclonal antibody (H4A3) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it is recommended to store at -20°C and avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.