| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Id3 |
| available sizes | 100 µg |
mouse anti-Id3 monoclonal antibody (2B11) 1683
$503.00
Antibody summary
- Mouse monoclonal to Id3
- Suitable for: WB,ICC/IF,IP
- Isotype: IgG1
- 100 µg
mouse anti-Id3 monoclonal antibody (2B11) 1683
| antibody |
|---|
| Tested applications WB,ICC/IF,IP |
| Recommended dilutions Immunoblotting and Immuno- precipitation: use at 1-5 ug/mL. Positive controls: Id3 transfected Sol8 muscles cells and recombinant fusion protein. |
| Immunogen Mouse Id3 gst-fusion protein (aa 1-119) expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer 10 mM PBS, pH 7.4. |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens ID3 DNA-binding protein inhibitor ID-3 |
| Protein names DNA-binding protein inhibitor ID-3 |
| Alternative names Class B basic helix-loop-helix protein 25, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21, Inhibitor of DNA binding 3, Inhibitor of differentiation 3 |
| Gene names ID3 |
| Function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer |
| Subcellular location Nucleus |
| Structure Homodimer, and heterodimer with other HLH proteins. Interacts with COPS5 and COPS7A. Interacts with IFI204. Interacts with GATA4 and NKX2-5. Interacts with ANKRD2; both proteins cooperate in myoblast differentiation (By similarity). Interacts with CLOCK and BMAL1 |
| Keywords 3D-structure, Biological rhythms, Myogenesis, Nucleus, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation |
| Sequence MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH |
| UniProt accession: Q02535 |
Data
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Id3 monoclonal antibody (2B11) been validated for?
This antibody has been tested and is suitable for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunoprecipitation (IP) applications.
What are the recommended storage conditions to maintain the stability of this Id3 antibody?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What immunogen was used to generate the mouse anti-Id3 monoclonal antibody (2B11)?
The antibody was raised against mouse Id3 GST-fusion protein comprising amino acids 1-119, which was expressed in E. coli.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.