| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Vitronectin |
| available sizes | 200 µg |
mouse anti-Human Vitronectin monoclonal antibody (VN58-1) 9971
$497.00
Antibody summary
- Mouse monoclonal to Human Vitronectin
- Suitable for: WB,ELISA,IHC
- Isotype: IgG1
- 200 µg
mouse anti-Human Vitronectin monoclonal antibody (VN58-1) 9971
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions ELISA: 1:3,000 dilution with solid phase antigen Western Blot: 5-10 ug/ml under reduced and non-reduced conditions. Immunohistochemistry: 5-10 ug/ml on paraffin embedded and frozen tissue sections. |
| Immunogen Human Vitronectin |
| Size and concentration 200µg and |
| Form lyophilized |
| Storage Instructions The stock solution (2. 0mg/ml) can be stored in aliquots at - 20°C for 1 year or can be stored at 4°C for 6 months after adding 0.1% sodium azide. Dilutions of stock solution should not |
| Storage buffer 10 mM PBS, 1% BSA, pH 7.4, lyophilized |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens VTN Vitronectin |
| Protein names Vitronectin |
| Alternative names S-protein, Serum-spreading factor, V75 |
| Gene names VTN |
| Function Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway |
| Subcellular location Parasitophorous vacuole |
| Structure (Microbial infection) Interacts (via hemopexin repeat 2) with P.falciparum (isolate CDC / Honduras) SERA5 P47 (via C-terminus); may form heterotetramers of two VTN and SERA5 P47 heterodimers; the interaction may protect merozoites from phagocytosis by host monocytes; VTN glycosylation appears to be dispensable for the interaction |
| Post-translational modification Sulfated on tyrosine residues N- and O-glycosylated Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both Phosphorylation sites are present in the extracellular medium |
| Keywords 3D-structure, Cell adhesion, Direct protein sequencing, Disulfide bond, Glycoprotein, Heparin-binding, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Secreted, Signal, Sulfation |
| Sequence MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| UniProt accession: P04004 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Human Vitronectin monoclonal antibody (VN58-1) been validated for?
This antibody has been tested and is suitable for Western Blot (WB), Enzyme-Linked Immunosorbent Assay (ELISA), and Immunohistochemistry (IHC). Recommended dilutions are 1:3,000 for ELISA with solid phase antigen, 5-10 µg/mL for Western Blot under both reduced and non-reduced conditions, and 5-10 µg/mL for IHC on paraffin embedded and frozen tissue sections.
How should the mouse anti-Human Vitronectin monoclonal antibody (VN58-1) be stored after reconstitution?
After reconstitution, the stock solution at 2.0 mg/mL can be stored in aliquots at -20°C for up to one year. Alternatively, it can be stored at 4°C for up to six months if 0.1% sodium azide is added. Dilutions of the stock solution should not be stored.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.