| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Platelet GMP-140 (P-selectin/CD62) |
| available sizes | 100 µg |
mouse anti-Human Platelet GMP-140 (P-selectin/CD62) monoclonal antibody (WGA-1) 7586
$586.00
Antibody summary
- Mouse monoclonal to Human Platelet GMP-140 (P-selectin/CD62)
- Suitable for: WB,IHC,IP,FACS,FC
- Isotype: IgG1
- 100 µg
mouse anti-Human Platelet GMP-140 (P-selectin/CD62) monoclonal antibody (WGA-1) 7586
| antibody |
|---|
| Tested applications WB,IHC,IHC,IP |
| Recommended dilutions ELISA: 1-10ug/ml with immobilized antigen.Flow cytometry: 1-10ug/mlWestern Blot: 5-10ug/ml, non-reducing and non-heating conditions. Immunohistochemistry: 5-10ug/ml, frozen tissue sections. |
| Immunogen Human platelets |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product does not contain preservative. Lyophilized antibody is stable at 4°C for 2 years. Store the reconstituted solution (2. 0mg/ml) in aliquots at -20°C for one year or at 4° |
| Storage buffer PBS, pH 7.4, 1% BSA, lyophilized. |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens SELP P-selectin |
| Protein names P-selectin |
| Alternative names CD62 antigen-like family member P, Granule membrane protein 140, Leukocyte-endothelial cell adhesion molecule 3, Platelet activation dependent granule-external membrane protein |
| Gene names SELP |
| Protein family Belongs to the selectin/LECAM family |
| Function Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with SELPLG. Mediates cell-cell interactions and cell adhesion via the interaction with integrin alpha-IIb/beta3 (ITGA2B:ITGB3) and integrin alpha-V/beta-3 (ITGAV:ITGB3) (PubMed:37184585) |
| Subcellular location Cell membrane |
| Structure Interacts with SNX17. Interacts with SELPLG/PSGL1 and PODXL2 and mediates neutrophil adhesion and leukocyte rolling. This interaction requires the sialyl-Lewis X epitope of SELPLG and PODXL2, and specific tyrosine sulfation on SELPLG. Interacts (via C-type lectin domain) with alpha-IIb/beta3 integrin ITGA2B:ITGB3 and alpha-V/beta-3 integrin ITGAV:ITGB3 (PubMed:37184585). Interacts with alpha5/beta1 integrin ITGA5:ITGB1 and alpha4/beta1 integrin ITGA4:ITGB (PubMed:37184585) |
| Keywords 3D-structure, Calcium, Cell adhesion, Cell membrane, Disulfide bond, EGF-like domain, Glycoprotein, Lectin, Lipoprotein, Membrane, Metal-binding, Palmitate, Proteomics identification, Reference proteome, Repeat, Signal, Sushi, Transmembrane, Transmembrane helix |
| Sequence MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPG TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP |
| UniProt accession: P16109 |
Data
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Human Platelet GMP-140 (P-selectin/CD62) monoclonal antibody (WGA-1) been tested in?
This antibody has been tested and is suitable for Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Flow Cytometry (FACS/FC), and Immunocytochemistry/Immunofluorescence (ICC/IF).
How should the lyophilized antibody be stored to ensure stability?
The lyophilized antibody is stable at 4°C for up to 2 years. Once reconstituted to 2.0 mg/mL, it should be aliquoted and stored at -20°C for up to one year or at 4°C for short-term use.
What is the host species and isotype of this monoclonal antibody?
The antibody is a mouse monoclonal with an IgG1 isotype.
What is the recommended dilution range for using this antibody in flow cytometry and Western blot assays?
For flow cytometry, the recommended antibody concentration is 1-10 µg/mL. For Western blot, use 5-10 µg/mL under non-reducing and non-heating conditions.
What is the immunogen used to generate this monoclonal antibody?
The immunogen for this antibody is human platelets.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.