Skip to content

mouse anti-Human E-cadherin monoclonal antibody (SHE78-7) 8192

$484.00

Antibody summary

  • Mouse monoclonal to Human E-cadherin
  • Suitable for: WB,ELISA,IHC,IF,FACS
  • Isotype: IgG2a
  • 100 µg
SKU: 8192parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2a

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

E-Cadherin

available sizes

100 µg

mouse anti-Human E-cadherin monoclonal antibody (SHE78-7) 8192

antibody
Tested applications
WB,IHC,IHC,ICC/IF,ELISA
Recommended dilutions
ELISA: 2ug/ml

Western Blotting

Flow : 2ug/ml, reducing and non-reducing conditions

Flow Cytometry: 1ug/ml.

Immunohistochemistry: 2ug/ml, paraffin- embedded and frozen tissue sections.

Immunofluorescence: 1ug/ml.Cell-Cell Contact Inhibition Assays: 1ug/ml.
Immunogen
Human placenta E-Cadherin
Size and concentration
100µg and
Form
lyophilized
Storage Instructions
Lyophilized antibody is stable at 4°C for 2 years. Store the reconstituted solution in aliquots at -20°C for one year or at 4°C for 6 months after addition of 0.1% sodium azide by th
Storage buffer
PBS, pH 7.4, lyophilized.
Purity
immunogen affinity purification
Clonality
monoclonal
Isotype
IgG2a
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2a - Isotype Control
target relevance
Homo sapiens CDH1
Cadherin-1
Protein names
Cadherin-1
Alternative names
CAM 120/80, Epithelial cadherin, Uvomorulin
Gene names
CDH1
Function
Cadherins are calcium-dependent cell adhesion proteins (PubMed:11976333). They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells (PubMed:11976333). Promotes organization of radial actin fiber structure and cellular response to contractile forces, via its interaction with AMOTL2 which facilitates anchoring of radial actin fibers to CDH1 junction complexes at the cell membrane (By similarity). Plays a role in the early stages of desmosome cell-cell junction formation via facilitating the recruitment of DSG2 and DSP to desmosome plaques (PubMed:29999492). Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7
Subcellular location
Cell junction, adherens junction, Cell membrane, Endosome, Golgi apparatus, trans-Golgi network, Cytoplasm, Cell junction, desmosome
Structure
(Microbial infection) Interacts with L.monocytogenes InlA (PubMed:12526809, PubMed:17540170, PubMed:17715295). The formation of the complex between InlA and cadherin-1 is calcium-dependent (PubMed:12526809)
Post-translational modification
During apoptosis or with calcium influx, cleaved by a membrane-bound metalloproteinase (ADAM10), PS1/gamma-secretase and caspase-3 (PubMed:10597309, PubMed:11076937, PubMed:11953314). Processing by the metalloproteinase, induced by calcium influx, causes disruption of cell-cell adhesion and the subsequent release of beta-catenin into the cytoplasm (PubMed:10597309). The residual membrane-tethered cleavage product is rapidly degraded via an intracellular proteolytic pathway (PubMed:10597309). Cleavage by caspase-3 releases the cytoplasmic tail resulting in disintegration of the actin microfilament system (PubMed:11076937). The gamma-secretase-mediated cleavage promotes disassembly of adherens junctions (PubMed:11953314). During development of the cochlear organ of Corti, cleavage by ADAM10 at adherens junctions promotes pillar cell separation (By similarity)
N-glycosylation at Asn-637 is essential for expression, folding and trafficking. Addition of bisecting N-acetylglucosamine by MGAT3 modulates its cell membrane location (PubMed:19403558)
Ubiquitinated by a SCF complex containing SKP2, which requires prior phosphorylation by CK1/CSNK1A1. Ubiquitinated by CBLL1/HAKAI, requires prior phosphorylation at Tyr-754
O-glycosylated. O-manosylated by TMTC1, TMTC2, TMTC3 or TMTC4. Thr-285 and Thr-509 are O-mannosylated by TMTC2 or TMTC4 but not TMTC1 or TMTC3
(Microbial infection) Cleaved by S.pyogenes SpeB protease; leading to its degradation (PubMed:23532847). Degradation by SpeB promotes bacterial translocation across the host epithelial barrier (PubMed:23532847)
Involvement in disease
Diffuse gastric and lobular breast cancer syndrome
A cancer predisposition syndrome with increased susceptibility to diffuse gastric cancer. Diffuse gastric cancer is a malignant disease characterized by poorly differentiated infiltrating lesions resulting in thickening of the stomach. Malignant tumors start in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. In addition to gastric cancer, most female mutation carriers develop lobular carcinoma of the breast.

Endometrial cancer
A malignancy of endometrium, the mucous lining of the uterus. Most endometrial cancers are adenocarcinomas, cancers that begin in cells that make and release mucus and other fluids.

Ovarian cancer
The term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease.

Breast cancer, lobular
A type of breast cancer that begins in the milk-producing glands (lobules) of the breast.

Blepharocheilodontic syndrome 1
A form of blepharocheilodontic syndrome, a rare autosomal dominant disorder. It is characterized by lower eyelid ectropion, upper eyelid distichiasis, euryblepharon, bilateral cleft lip and palate, and features of ectodermal dysplasia, including hair anomalies, conical teeth and tooth agenesis. An additional rare manifestation is imperforate anus. There is considerable phenotypic variability among affected individuals.

Keywords
3D-structure, Alternative splicing, Calcium, Cell adhesion, Cell junction, Cell membrane, Cleavage on pair of basic residues, Cytoplasm, Direct protein sequencing, Disease variant, Disulfide bond, Ectodermal dysplasia, Endosome, Glycoprotein, Golgi apparatus, Membrane, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
UniProt accession: P12830

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-Human E-cadherin monoclonal antibody (SHE78-7) validated for?
This antibody is validated for use in Western Blotting (WB), Enzyme-Linked Immunosorbent Assay (ELISA), Immunohistochemistry (IHC), Immunocytochemistry/Immunofluorescence (ICC/IF), and Flow Cytometry (FACS). Recommended dilutions vary by application, such as 2 µg/ml for ELISA and IHC, and 1 µg/ml for Flow Cytometry and Immunofluorescence.
How should the mouse anti-Human E-cadherin monoclonal antibody (SHE78-7) be stored to maintain stability?
The lyophilized antibody is stable at 4°C for up to 2 years. After reconstitution, it should be aliquoted and stored at -20°C for one year or at 4°C for up to 6 months, with the addition of 0.1% sodium azide to prevent microbial growth.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.