mouse anti-GFAP monoclonal antibody (2E1) 9024

$409.00

Antibody summary

Mouse monoclonal to GFAP
Suitable for: WB, ICC/IF, IHC
Reacts with: human, mouse, rat
Isotype: IgG2b
100 µg

SKU: 9024 Categories: antibody, cell marker Tag: GFAP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	100 µg

mouse anti-GFAP monoclonal antibody (2E1) 9024

antibody
Database link: human P14136 mouse P03995 rat P47819
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:5000 IF/ICC and IHC 1:1000-1,5000
Immunogen Recombinant full length human GFAP isotype 1 expressed in and purified from E. coli.
Size and concentration 100µL and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity serum
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monocolonal IgG2b - Isotype Control

target relevance
Homo sapiens GFAP Glial fibrillary acidic protein
Protein names Glial fibrillary acidic protein
Gene names GFAP
Protein family Belongs to the intermediate filament family
Function GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells
Subcellular location Cytoplasm
Structure Interacts with PSEN1 (via N-terminus)
Post-translational modification Phosphorylated by PKN1
Involvement in disease Alexander disease A rare disorder of the central nervous system. The most common form affects infants and young children, and is characterized by progressive failure of central myelination, usually leading to death within the first decade. Infants with Alexander disease develop a leukodystrophy with macrocephaly, seizures, and psychomotor retardation. Patients with juvenile or adult forms typically experience ataxia, bulbar signs and spasticity, and a more slowly progressive course. Histologically, Alexander disease is characterized by Rosenthal fibers, homogeneous eosinophilic inclusions in astrocytes.
Keywords 3D-structure, Alternative splicing, Citrullination, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Intermediate filament, Leukodystrophy, Methylation, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNA GFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAEL RELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEAT LARLDLERKIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRT QYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLR GTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALD IEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM
UniProt accession: P14136

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-1.jpg

Western blot analysis of GFAP expression in C6 (A), U-87 MG (B), SK-N-SH (C) and U-251-MG (D) whole cell lysates. Detection reagent used: m-IgGκ BP-HRP.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-2.jpg

Immunoperoxidase staining of formalin fixed, paraffin-embedded human cerebral cortex tissue showing cytoplasmic staining of astrocytes and neuropil staining.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-3.jpg

Direct fluorescent western blot analysis of GFAP expression in U-251-MG whole cell lysate.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-4.jpg

Western blot analysis of GFAP expression in U-87 MG (A), U-251-MG (B), C2C12 (C) and Neuro-2A (D) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-5.jpg

Direct near-infrared western blot analysis of GFAP expression in human brain tissue extract.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-6.jpg

Immunoperoxidase staining of formalin fixed, paraffin-embedded human brain showing staining of astrocytes.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-7.jpg

Near-Infrared western blot analysis of GFAP expression in non-transfected 293T (A), human GFAP transfected 293T (B), C6 (C) and U-251-MG (D) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-8.jpg

Western blot analysis of GFAP expression in C6 whole cell lysate (A) and mouse brain tissue extract (B).

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-9.jpg

Near-Infrared western blot analysis of GFAP expression in non-transfected (A) human GFAP transfected 293T (B) and human GFAP transfected 293T (C) whole cell lysates.

benchmarkantibodies.com/wp-content/uploads/2024/03/9024-10.jpg

Western blot analysis of GFAP expression in rat brain tissue extract.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-GFAP monoclonal antibody (2E1) 9024 react with?

This antibody reacts with human, mouse, and rat GFAP proteins.

Which applications has the mouse anti-GFAP monoclonal antibody (2E1) been validated for?

It has been tested and is suitable for Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC) applications.

How should the mouse anti-GFAP monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, avoiding freeze/thaw cycles to preserve antibody integrity.

What is the immunogen used to generate the mouse anti-GFAP monoclonal antibody (2E1) 9024?

The immunogen is recombinant full-length human GFAP isotype 1 expressed in and purified from Escherichia coli (E. coli).

Publications

pmid	title	authors	citation
37759938	Neuroimmune Support of Neuronal Regeneration and Neuroplasticity following Cerebral Ischemia in Juvenile Mice.	Ricaurte A Marquez-Ortiz, Vesna Tesic, Daniel R Hernandez, Bilkis Akhter, Nibedita Aich, Porter M Boudreaux, Garrett A Clemons, Celeste Yin-Chieh Wu, Hung Wen Lin, Krista M Rodgers	Brain Sci 13:N/A
37667307	Metal-organic framework materials promote neural differentiation of dental pulp stem cells in spinal cord injury.	Heng Zhou, Shuili Jing, Wei Xiong, Yangzhi Zhu, Xingxiang Duan, Ruohan Li, Youjian Peng, Tushar Kumeria, Yan He, Qingsong Ye	J Nanobiotechnology 21:316
37605262	Inhibition of acid sphingomyelinase reduces reactive astrocyte secretion of mitotoxic extracellular vesicles and improves Alzheimer's disease pathology in the 5xFAD mouse.	Simone M Crivelli, Zainuddin Quadri, Hemendra J Vekaria, Zhihui Zhu, Priyanka Tripathi, Ahmed Elsherbini, Liping Zhang, Patrick G Sullivan, Erhard Bieberich	Acta Neuropathol Commun 11:135
37587766	USP25 Inhibits Neuroinflammatory Responses After Cerebral Ischemic Stroke by Deubiquitinating TAB2.	Zhongding Li, Baohua Liu, Kate Lykke Lambertsen, Bettina Hjelm Clausen, Zhenhu Zhu, Xue Du, Yanqi Xu, Frantz Rom Poulsen, Bo Halle, Christian Bonde, Meng Chen, Xue Wang, Dirk Schlüter, Jingyong Huang, Ari Waisman, Weihong Song, Xu Wang	Adv Sci (Weinh) 10:e2301641
37513944	EYE-503: A Novel Retinoic Acid Drug for Treating Retinal Neurodegeneration.	Sha Liu, Yuke Ji, Huan Li, Ling Ren, Junya Zhu, Tianjing Yang, Xiumiao Li, Jin Yao, Xin Cao, Biao Yan	Pharmaceuticals (Basel) 16:N/A

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.