Immunohistochemistry (IHC) : Human breast tissue stained with anti-GCDFP-15 antibody using peroxidase-conjugate and DAB chromogen. Note luminal and cytoplasmic staining of glandular epithelial cells.

mouse anti-GCDFP-15 monoclonal antibody (ZM23) 6425

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to GCDFP-15
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Skin and breast
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6425parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, GCDFP-15

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-GCDFP-15 monoclonal antibody ZM23 6425

antibody
Database link: human P12273
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Skin and breast
Immunogen Conserved peptide between the GATA trans-activation and DNA-binding domain
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens PIP Prolactin-inducible protein
Protein names Prolactin-inducible protein
Alternative names Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17
Gene names PIP
Protein family Belongs to the PIP family
Subcellular location Secreted
Structure Monomer. Interacts with AZGP1
Keywords 3D-structure, Actin-binding, Direct protein sequencing, Disulfide bond, Glycoprotein, Proteomics identification, Pyrrolidone carboxylic acid, Reference proteome, Secreted, Signal
Sequence MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQT ELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIREL GICPDDAAVIPIKNNRFYTIEILKVE
UniProt accession: P12273

Data

Human breast tissue stained with anti-GCDFP-15 antibody using peroxidase-conjugate and DAB chromogen. Note luminal and cytoplasmic staining of glandular epithelial cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-GCDFP-15 monoclonal antibody (ZM23) suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, specifically validated for use in skin and breast tissue samples.

How should the mouse anti-GCDFP-15 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

What is the species reactivity and isotype of the mouse anti-GCDFP-15 monoclonal antibody (ZM23)?

The antibody reacts with human GCDFP-15 and is a mouse monoclonal antibody of the IgG2b isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.