Immunohistochemistry (IHC) : Human breast carcinoma stained with anti-GATA3 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

mouse anti-GATA-3 monoclonal antibody (L50-823) 6191

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to GATA-3
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Urothelial carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6191parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Breast Pathology, GATA-3

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-GATA-3 monoclonal antibody L50-823 6191

antibody
Database link: human P23771
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Urothelial carcinoma
Immunogen Conserved peptide between the GATA trans-activation and DNA-binding domain
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens GATA3 Trans-acting T-cell-specific transcription factor GATA-3
Protein names Trans-acting T-cell-specific transcription factor GATA-3
Alternative names GATA-binding factor 3
Gene names GATA3
Function Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses. Positively regulates ASB2 expression (By similarity). Coordinates macrophage transcriptional activation and UCP2-dependent metabolic reprogramming in response to IL33. Upon tissue injury, acts downstream of IL33 signaling to drive differentiation of inflammation-resolving alternatively activated macrophages
Subcellular location Nucleus
Structure Interacts with TBX21 ('Tyr-530' phosphorylated form)
Involvement in disease Hypoparathyroidism, sensorineural deafness, and renal disease A disease characterized by steroid-resistant nephrosis with progressive renal failure, hypoparathyroidism, sensorineural deafness, and renal dysplasia.
Keywords 3D-structure, Activator, Alternative splicing, Deafness, Disease variant, DNA-binding, Immunity, Innate immunity, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Transcription, Transcription regulation, Zinc, Zinc-finger
Sequence MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG
UniProt accession: P23771

Data

Human breast carcinoma stained with anti-GATA3 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-GATA-3 monoclonal antibody (L50-823) react with?

This antibody specifically reacts with human tissues.

In which applications has the mouse anti-GATA-3 monoclonal antibody been validated for use?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-GATA-3 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, it should be kept at -20°C. Avoid repeated freeze-thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.