| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Excitatory Amino Acid Transporter 1 |
| available sizes | 100 µg |
mouse anti-Excitatory Amino Acid Transporter 1 monoclonal antibody (2G7C2) 8730
$520.00
Antibody summary
- Mouse monoclonal to Excitatory Amino Acid Transporter 1
- Suitable for: WB,IHC,ELISA
- Isotype: IgG1
- 100 µg
mouse anti-Excitatory Amino Acid Transporter 1 monoclonal antibody (2G7C2) 8730
| antibody |
|---|
| Tested applications WB,IHC,IHC,ELISA |
| Recommended dilutions ELISA: use at 0.1-2ug/ml Immunoblotting: User should use at 1-5ug/ml. A band of ~60kDa is detected. Immunohistochemistry: Use at 2- 10ug/ml. These are recommended concentrations. End user should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide derived from the C-terminal domain of rat EAAT1. Accession no. P24942. |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Rattus norvegicus SLC1A3 Excitatory amino acid transporter 1 |
| Protein names Excitatory amino acid transporter 1 |
| Alternative names Glial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 1, Solute carrier family 1 member 3 |
| Gene names Slc1a3 |
| Protein family Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family. SLC1A3 subfamily |
| Function Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:1279699, PubMed:8387171). Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion (By similarity). Plays a redundant role in the rapid removal of released glutamate from the synaptic cleft, which is essential for terminating the postsynaptic action of glutamate (By similarity) |
| Catalytic activity K(+)(in) + L-glutamate(out) + 3 Na(+)(out) + H(+)(out) = K(+)(out) + L-glutamate(in) + 3 Na(+)(in) + H(+)(in) K(+)(in) + L-aspartate(out) + 3 Na(+)(out) + H(+)(out) = K(+)(out) + L-aspartate(in) + 3 Na(+)(in) + H(+)(in) D-aspartate(out) + K(+)(in) + 3 Na(+)(out) + H(+)(out) = D-aspartate(in) + K(+)(out) + 3 Na(+)(in) + H(+)(in) |
| Subcellular location Cell membrane |
| Structure Homotrimer (By similarity) |
| Post-translational modification Glycosylated |
| Keywords Alternative splicing, Amino-acid transport, Cell membrane, Chloride, Direct protein sequencing, Glycoprotein, Membrane, Metal-binding, Phosphoprotein, Potassium, Reference proteome, Sodium, Symport, Transmembrane, Transmembrane helix, Transport |
| Sequence MTKSNGEEPRMGSRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVSAVIV GTILGFALRPYKMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMYREGKIVQVTAADAFLDLIRNMFPP NLVEACFKQFKTSYEKRSFKVPIQANETLLGAVINNVSEAMETLTRIREEMVPVPGSVNG VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPLGILFLIAGK ILEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL GTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEALAAIFIAQVNNFD LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNEPEKPVADSE TKM |
| UniProt accession: P24942 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Excitatory Amino Acid Transporter 1 monoclonal antibody (2G7C2) validated for?
This antibody is suitable for Western blotting (WB), immunohistochemistry (IHC), and ELISA applications. Recommended dilutions are 1-5 µg/mL for immunoblotting, 2-10 µg/mL for immunohistochemistry, and 0.1-2 µg/mL for ELISA.
How should the mouse anti-Excitatory Amino Acid Transporter 1 monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable for at least one year when stored at -20°C to -70°C. After reconstitution, it should be aliquoted and stored appropriately to avoid repeated freeze-thaw cycles, which can degrade the antibody.
What is the immunogen used to generate this mouse monoclonal antibody against Excitatory Amino Acid Transporter 1?
The immunogen is a synthetic peptide derived from the C-terminal domain of rat Excitatory Amino Acid Transporter 1, corresponding to UniProt accession number P24942.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.