Immunohistochemistry (IHC) : Human breast stained with antibody CAM 5.2 using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of ductal cells.

mouse anti-Cytokeratin monoclonal antibody (CAM 5.2) 6134

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Ovarian carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6134parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin monoclonal antibody CAM 5.2 6134

antibody
Database link: human P04264
Tested applications IHC
Recommended dilutions Concentrated 1:10
Application Notes Positive control: Ovarian carcinoma
Immunogen Purified human Keratin 8
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens KRT1 Keratin, type II cytoskeletal 1
Protein names Keratin, type II cytoskeletal 1
Alternative names 67 kDa cytokeratin, Cytokeratin-1, Hair alpha protein, Keratin-1, Type-II keratin Kb1
Gene names KRT1
Protein family Belongs to the intermediate filament family
Function May regulate the activity of kinases such as PKC and SRC via binding to integrin beta-1 (ITB1) and the receptor of activated protein C kinase 1 (RACK1). In complex with C1QBP is a high affinity receptor for kininogen-1/HMWK
Subcellular location Cell membrane, Cytoplasm
Structure Heterotetramer of two type I and two type II keratins (PubMed:24940650, PubMed:27595935). Heterodimer with KRT10 (PubMed:24940650, PubMed:27595935). Two heterodimers of KRT1 and KRT10 form a heterotetramer (PubMed:27595935). Forms a heterodimer with KRT14; the interaction is more abundant in the absence of KRT5 (By similarity). Interacts with PLEC isoform 1C, when in a heterodimer with KRT10 (PubMed:24940650). Interacts with ITGB1 in the presence of RACK1 and SRC, and with RACK1 (PubMed:17956333). Interacts with C1QBP; the association represents a cell surface kininogen receptor (PubMed:21544310). Interacts with EPPK1; interaction is dependent of higher-order structure of intermediate filament (PubMed:16923132)
Post-translational modification Undergoes deimination of some arginine residues (citrullination)
Involvement in disease Epidermolytic hyperkeratosis 1 A skin disorder characterized by widespread blistering and an ichthyotic erythroderma at birth that persist into adulthood. Histologically there is a diffuse epidermolytic degeneration in the lower spinous layer of the epidermis. Within a few weeks from birth, erythroderma and blister formation diminish and hyperkeratoses develop. EHK1 inheritance is autosomal dominant or autosomal recessive. Ichthyosis hystrix, Curth-Macklin type A genodermatosis with severe verrucous hyperkeratosis. Affected individuals manifest congenital verrucous black scale on the scalp, neck, and limbs with truncal erythema, palmoplantar keratoderma and keratoses on the lips, ears, nipples and buttocks. Keratoderma, palmoplantar, non-epidermolytic A dermatological disorder characterized by well-demarcated hyperkeratosis is present over the palms and soles. A red band is frequently present at the periphery of the keratosis. It is usually non-transgredient, with a sharp demarcation of the lesions at the wrists. Ichthyosis, annular epidermolytic, 2 A form of annular epidermolytic ichthyosis, an autosomal dominant skin disorder characterized by polycyclic, migratory erythematous and scaly plaques. AEI2 patients manifest erythema and blistering of skin at birth that improves without scarring, as well as palmoplantar keratoderma. Keratoderma, palmoplantar, striate 3 A dermatological disorder characterized by thickening of the stratum corneum and epidermal layers on palms and soles. There is no involvement of non-palmoplantar skin, and both hair and nails are normal. Palmoplantar keratoderma, epidermolytic, 2 A form of epidermolytic palmoplantar keratoderma, a dermatological disorder characterized by diffuse thickening of the epidermis on the entire surface of palms and soles sharply bordered with erythematous margins. Some patients may present knuckle pads, thick pads of skin appearing over the proximal phalangeal joints. EPPK2 is an autosomal dominant form in which hyperkeratosis is restricted to palms and soles and is apparent from birth or childhood.
Keywords 3D-structure, Cell membrane, Citrullination, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Ichthyosis, Intermediate filament, Keratin, Membrane, Methylation, Palmoplantar keratoderma, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFG GFGSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRE REQIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRR RVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVD LQAKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYED IAQKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQIS NLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIA TYRTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGSRGGGGGGYGSGGSSYGSGGGSYG SGGGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSG GRGSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
UniProt accession: P04264

Data

Human breast stained with antibody CAM 5.2 using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of ductal cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Cytokeratin monoclonal antibody (CAM 5.2) 6134 react with?

This antibody is reactive with human tissues and is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded human tissue samples.

How should the CAM 5.2 antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.