Immunohistochemistry (IHC) : Human colon carcinoma stained with anti-Cyclin D1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

mouse anti-Cyclin-E monoclonal antibody (ZM121) 6133

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cyclin-E
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Colon carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6133parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cyclin-E, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cyclin-E monoclonal antibody ZM121 6133

antibody
Database link: human P24864
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Colon carcinoma
Immunogen Recombinant human Cyclin E (CCNE1) protein fragment (around aa 10-176)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens CCNE1 G1/S-specific cyclin-E1
Protein names G1/S-specific cyclin-E1
Gene names CCNE1
Protein family Belongs to the cyclin family. Cyclin E subfamily
Function Essential for the control of the cell cycle at the G1/S (start) transition
Subcellular location Nucleus
Structure Interacts with CDK2 protein kinase to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex (PubMed:15660127). Found in a complex with CDK2, CABLES1 and CCNA1 (By similarity). Part of a complex consisting of UHRF2, CDK2 and CCNE1 (PubMed:15178429). Interacts directly with UHRF2; the interaction ubiquitinates CCNE1 and appears to occur independently of CCNE1 phosphorylation (PubMed:21952639). Interacts with INCA1 (PubMed:21540187)
Post-translational modification Phosphorylation of both Thr-395 by GSK3 and Ser-399 by CDK2 creates a high affinity degron recognized by FBXW7, and accelerates degradation via the ubiquitin proteasome pathway. Phosphorylation at Thr-77 creates a low affinity degron also recognized by FBXW7 Ubiquitinated by UHRF2; appears to occur independently of phosphorylation
Keywords 3D-structure, Alternative splicing, Cell cycle, Cell division, Cyclin, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
UniProt accession: P24864

Data

Human colon carcinoma stained with anti-Cyclin D1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Cyclin-E monoclonal antibody (ZM121) validated for, and what control tissue is recommended?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. Colon carcinoma tissue is recommended as a positive control for staining.

How should the mouse anti-Cyclin-E monoclonal antibody be stored to maintain stability, and what are the available concentrations?

For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, store at -20°C while avoiding repeated freeze/thaw cycles. The antibody is available in concentrated formats of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.