Skip to content

mouse anti-cdc34 monoclonal antibody (14B5) 7470

$503.00

Antibody summary

  • Mouse monoclonal to cdc34
  • Suitable for: WB,ICC/IF,IHC-P,IP
  • Isotype: IgG1
  • 100 µg
SKU: 7470parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

cdc34

available sizes

100 µg

mouse anti-cdc34 monoclonal antibody (14B5) 7470

antibody
Tested applications
WB,IHC,IHC,ICC/IF
Recommended dilutions
Immunoblotting and Immuno-precipitation: use at 1-5 ug/mL.

Positive controls: 293 cells and recombinant fusion protein.
Immunogen
N-terminus 6x-His tagged fusion protein encoding full-length human Cdc34 expressed in E. coli.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles.
Storage buffer
10 mM PBS, pH 7.4.
Purity
immunogen affinity purification
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG1 - Isotype Control
target relevance
Homo sapiens CDC34
Ubiquitin-conjugating enzyme E2 R1
Protein names
Ubiquitin-conjugating enzyme E2 R1
Alternative names
(E3-independent) E2 ubiquitin-conjugating enzyme R1, E2 ubiquitin-conjugating enzyme R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1
Gene names
CDC34
Protein family
Belongs to the ubiquitin-conjugating enzyme family
Function
E2 ubiquitin-conjugating enzyme that accepts ubiquitin from an E1 ubiquitin-activating protein, and catalyzes its covalent attachment to other proteins by an E3 ubiquitin-protein ligase complex (PubMed:10329681, PubMed:17588522, PubMed:20061386, PubMed:38326650). In vitro catalyzes 'Lys-48'-linked polyubiquitination (PubMed:22496338). Cooperates with the E2 UBCH5C and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation (PubMed:10329681, PubMed:10918611, PubMed:17698585). Performs ubiquitin chain elongation building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. UBE2D3 acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys-22' with a monoubiquitin. Cooperates with the SCF(SKP2) E3 ligase complex to regulate cell proliferation through ubiquitination and degradation of MYBL2 and KIP1 (PubMed:10871850, PubMed:15652359, PubMed:19112177). Involved in ubiquitin conjugation and degradation of CREM isoform ICERIIgamma and ATF15 resulting in abrogation of ICERIIgamma- and ATF5-mediated repression of cAMP-induced transcription during both meiotic and mitotic cell cycles. Involved in the regulation of the cell cycle G2/M phase through its targeting of the WEE1 kinase for ubiquitination and degradation (PubMed:19126550). Also involved in the degradation of beta-catenin (PubMed:12037680). Is target of human herpes virus 1 protein ICP0, leading to ICP0-dependent dynamic interaction with proteasomes (PubMed:11805320, PubMed:12060736)
Catalytic activity
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.
Subcellular location
Cytoplasm, Nucleus
Structure
Interacts with multiple Cul1-RING E3 ubiquitin-protein ligase complexes, also known as SCF (SKP1-CUL1-F-box protein) complexes (PubMed:10918611, PubMed:11675391, PubMed:18851830, PubMed:19112177, PubMed:19945379, PubMed:24316736). Identified in a SCF E3 ubiquitin ligase complex together with HINT1 and RBX1 (PubMed:19112177). When cullin is neddylated, the interaction between the E2 and the SCF complex is strengthened (PubMed:10918611, PubMed:11675391, PubMed:18851830, PubMed:19112177, PubMed:19945379, PubMed:24316736). Interacts with multiple Cul2-RING (CRL2) E3 ubiquitin-protein ligase complexes, also known as ECS (Elongin BC-CUL2/5-SOCS-box protein) complexes (PubMed:38326650). When phosphorylated, interacts with beta-TrCP (BTRC) (PubMed:12037680). Interacts with human herpes virus 1 protein ICP0 and associates with the proteasome for degradation (PubMed:11447293, PubMed:11805320, PubMed:12060736). Interacts with casein kinase subunit CSNK2B (PubMed:11546811). Interacts with CNTD1; this interaction regulates the cell-cycle progression (By similarity)
Post-translational modification
Autoubiquitinated (PubMed:11805320, PubMed:12060736, PubMed:22496338). Autoubiquitination is promoted by the human herpes virus 1 protein ICP0 and leads to degradation by the Ubiquitin-proteasomal pathway (PubMed:11805320, PubMed:12060736)
Phosphorylated by CK2. Phosphorylation of the C-terminal tail by CK2 controls the nuclear localization
Keywords
3D-structure, ATP-binding, Cell cycle, Cytoplasm, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Ubl conjugation, Ubl conjugation pathway
Sequence
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
UniProt accession: P49427

Data

benchmark-antibodies_anti-cdc34_antibody_7470_1.jpg
Sample (30 µg of whole cell lysate)
A: A549
B: HCT116
10% SDS PAGE
7470 diluted at 1:1000
benchmark-antibodies_anti-cdc34_antibody_7470_2.jpg
Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using CDC34(7470) antibody at 1:200 dilution.
benchmark-antibodies_anti-cdc34_antibody_7470_3.jpg
Immunofluorescence analysis of paraformaldehyde-fixed HeLa, using CDC34(7470) antibody at 1:100 dilution.

FAQ & Publications

Frequently Asked Questions
What applications has the mouse anti-Cdc34 monoclonal antibody (14B5) been validated for?
This antibody is suitable for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), immunohistochemistry on paraffin-embedded sections (IHC-P), and immunoprecipitation (IP). Recommended dilutions are 1-5 µg/mL for immunoblotting and immunoprecipitation.
How should the mouse anti-Cdc34 monoclonal antibody (14B5) be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the mouse anti-Cdc34 monoclonal antibody (14B5)?
The immunogen is an N-terminus 6x-His tagged fusion protein encoding full-length human Cdc34 expressed in Escherichia coli.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.