Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human Ewing’s sarcoma stained with clone ZM139 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

mouse anti-CD99 monoclonal antibody (ZM139) 6117

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD99
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Ewing’s sarcoma
Visualization: Cell membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6117parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD99, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD99 monoclonal antibody ZM139 6117

antibody
Database link: human P14209
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Ewing's sarcoma
Immunogen Purified E-rosette forming cells from human peripheral blood lymphocytes
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD99 CD99 antigen
Protein names CD99 antigen
Alternative names 12E7, E2 antigen, Protein MIC2, T-cell surface glycoprotein E2
Gene names CD99
Protein family Belongs to the CD99 family
Function Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes (By similarity)
Subcellular location Membrane
Post-translational modification Extensively O-glycosylated
Keywords 3D-structure, Alternative splicing, Cell adhesion, Direct protein sequencing, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR TLLEK
UniProt accession: P14209

Data

Formalin-fixed, paraffin-embedded human Ewing's sarcoma stained with clone ZM139 antibody using peroxidase-conjugate and DAB chromogen. Note the cell membrane staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD99 monoclonal antibody (ZM139) specifically react with?

This antibody is reactive with human species, as indicated in its reactivity profile.

For which applications is the mouse anti-CD99 monoclonal antibody (ZM139) validated?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-CD99 monoclonal antibody (ZM139) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, store it at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

What is the immunogen used to generate the mouse anti-CD99 monoclonal antibody (ZM139)?

The antibody was generated using purified E-rosette forming cells from human peripheral blood lymphocytes as the immunogen.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.