Immunohistochemistry (IHC) : Human tonsil stained with anti-CD11c antibody using peroxidase-conjugate and DAB chromogen. Note strong membranous staining of lymphocytes.

mouse anti-CD11c monoclonal antibody (ZM103) 6057

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD11c
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Tonsil, lymph node
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6057parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD11c, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD11c monoclonal antibody ZM103 6057

antibody
Database link: human P20702
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil, lymph node
Immunogen Recombinant human ITGAX protein fragment (aa 637-827)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens ITGAX Integrin alpha-X
Protein names Integrin alpha-X
Alternative names CD11 antigen-like family member C, Leu M5, Leukocyte adhesion glycoprotein p150,95 alpha chain, Leukocyte adhesion receptor p150,95
Gene names ITGAX
Protein family Belongs to the integrin alpha chain family
Function Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis. Functions as a receptor of the erythrocyte-specific adhesion molecule ICAM4 and mediates erythrophagocytosis (PubMed:16985175)
Subcellular location Cell membrane
Structure Heterodimer of an alpha and a beta subunit. Alpha-X associates with beta-2
Keywords 3D-structure, Calcium, Cell adhesion, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, Integrin, Magnesium, Membrane, Metal-binding, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM MEEANGQIAPENGTQTPSPPSEK
UniProt accession: P20702

Data

Human tonsil stained with anti-CD11c antibody using peroxidase-conjugate and DAB chromogen. Note strong membranous staining of lymphocytes.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD11c monoclonal antibody (ZM103) specifically react with?

This antibody is reactive with human species, making it suitable for studies involving human tissue samples.

Which applications and tissue types is the anti-CD11c antibody validated for?

The antibody is validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with tonsil and lymph node tissues recommended as positive controls.

How should the mouse anti-CD11c monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.