Skip to content

mouse anti-Cardiac Tropinin T monoclonal antibody (1C11) 9482

$235.00

Antibody summary

  • Mouse monoclonal to Cardiac Tropinin T
  • Suitable for: ELISA
  • Isotype: IgG1
  • 100 µg
SKU: 9482parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Cardiac Troponin T

available sizes

100 µg

mouse anti-Cardiac Tropinin T monoclonal antibody (1C11) 9482

antibody
Tested applications
ELISA
Recommended dilutions
These antibodies may be used in immunoassays to detect and quantitate human cardiac troponin T. They may also be used to affinity purify cardiac troponin T.
Immunogen
Purified human cardiac troponin T.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles.
Storage buffer
PBS containing 0.1% NaN3
Purity
protein affinity purification
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG1 - Isotype Control
target relevance
Homo sapiens TNNT2
Troponin T, cardiac muscle
Protein names
Troponin T, cardiac muscle
Alternative names
Cardiac muscle troponin T
Gene names
TNNT2
Protein family
Belongs to the troponin T family
Function
Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity
Post-translational modification
Phosphorylation at Thr-213 by PRKCA induces significant reduction in myofilament calcium sensitivity and actomyosin ATPase activity
Involvement in disease
Cardiomyopathy, familial hypertrophic, 2
A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.

Cardiomyopathy, dilated, 1D
A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.

Cardiomyopathy, familial restrictive 3
A heart disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.

Keywords
3D-structure, Acetylation, Alternative splicing, Cardiomyopathy, Direct protein sequencing, Disease variant, Muscle protein, Phosphoprotein, Proteomics identification, Reference proteome
Sequence
MSDIEEVVEEYEEEEQEEAAVEEEEDWREDEDEQEEAAEEDAEAEAETEETRAEEDEEEE EAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHF ENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAED EARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLR EKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
UniProt accession: P45379

Data

No results found

FAQ & Publications

Frequently Asked Questions
What is the recommended storage condition for the mouse anti-Cardiac Troponin T monoclonal antibody (1C11)?
The antibody should be stored at temperatures between -20°C and -70°C in appropriate aliquots to avoid multiple freeze-thaw cycles. Under these conditions, it remains stable for at least one year.
Which applications has the mouse anti-Cardiac Troponin T monoclonal antibody (1C11) been validated for?
This monoclonal antibody has been tested and is suitable for use in ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blot (WB) applications.
What is the immunogen used to generate the mouse anti-Cardiac Troponin T monoclonal antibody (1C11)?
The antibody was raised against purified human cardiac troponin T protein as the immunogen.
Publications
pmid title authors citation
36499727 INO80 Is Required for the Cell Cycle Control, Survival, and Differentiation of Mouse ESCs by Transcriptional Regulation. Seonho Yoo, Eun Joo Lee, Nguyen Xuan Thang, Hyeonwoo La, Hyeonji Lee, Chanhyeok Park, Dong Wook Han, Sang Jun Uhm, Hyuk Song, Jeong Tae Do, Youngsok Choi, Kwonho Hong Int J Mol Sci 23:N/A
36438566 Immunosuppressants Tacrolimus and Sirolimus revert the cardiac antifibrotic properties of p38-MAPK inhibition in 3D-multicellular human iPSC-heart organoids. Yu Tian, Yuta Tsujisaka, Vanessa Y Li, Kanae Tani, Antonio Lucena-Cacace, Yoshinori Yoshida Front Cell Dev Biol 10:1001453
36335128 Dusp6 deficiency attenuates neutrophil-mediated cardiac damage in the acute inflammatory phase of myocardial infarction. Xiaohai Zhou, Chenyang Zhang, Xueying Wu, Xinli Hu, Yan Zhang, Xuelian Wang, Lixia Zheng, Peng Gao, Jianyong Du, Wen Zheng, Haibao Shang, Keping Hu, Zhengfan Jiang, Yu Nie, Shengshou Hu, Rui-Ping Xiao, Xiaojun Zhu, Jing-Wei Xiong Nat Commun 13:6672
36147944 A scalable and tunable thermoreversible polymer for 3D human pluripotent stem cell biomanufacturing. Hunter J Johnson, Saheli Chakraborty, Riya J Muckom, Nitash P Balsara, David V Schaffer iScience 25:104971
36082129 CDK9 binds and activates SGK3 to promote cardiac repair after injury via the GSK-3β/β-catenin pathway. Jiateng Sun, Tongtong Yang, Tianwen Wei, Liuhua Zhou, Tiankai Shan, Jiawen Chen, Lingfeng Gu, Bingrui Chen, Liu Liu, Qiqi Jiang, Chong Du, Yao Ma, Hao Wang, Feng Chen, Xuejiang Guo, Yong Ji, Liansheng Wang Front Cardiovasc Med 9:970745

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
ELISA

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.