Immunohistochemistry (IHC) : Human rejected kidney stained with anti-C4d antibody using peroxidase-conjugate and DAB chromogen. Note basement membrane/cytoplasmic staining of renal tubules.

mouse anti-C4d monoclonal antibody (ZM78) 6042

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to C4d
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Acute rejected kidney transplant
Visualization: Membrane or cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6042parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, C4d, Transplantation Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-C4d monoclonal antibody ZM78 6042

antibody
Database link: human P0C0L4
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Acute rejected kidney transplant
Immunogen Recombinant full-length human complement 4d protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens C4A Complement C4-A
Protein names Complement C4-A
Alternative names Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2
Gene names C4A
Function Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system
Subcellular location Secreted, Cell surface
Structure Complement C4b is composed of complement C4b-A, complement C4 beta and complement C4 gamma chains that are associated via disulfide bonds (PubMed:22949645, PubMed:27599733). Non-enzymatic component of the C3 convertase, also named C4bC2b, composed of the serine protease complement C2b (C2), as well as complement C4b (PubMed:27252379, PubMed:3874204, PubMed:6906228). Non-enzymatic component of the C5 convertase, also named C4bC2bC3b, composed of the serine protease complement C2b (C2), complement C3b, as well as complement C4b (PubMed:12878586, PubMed:1740458, PubMed:18204047, PubMed:2387864)
Post-translational modification Prior to secretion, the single-chain precursor is enzymatically cleaved by plasminogen (PLG) to yield non-identical chains alpha, beta and gamma (PubMed:76991). During activation of the complement systems, the alpha chain is cleaved into C4a and C4b by different proteases depending on the complement pathway: C4b stays linked to the beta and gamma chains, while C4a is released in the plasma (PubMed:11527969, PubMed:16169853, PubMed:22949645, PubMed:467643, PubMed:6319179, PubMed:9422791). The alpha chain is cleaved by C1S to generate C4a and C4b following activation by the classical complement system (PubMed:11527969, PubMed:16169853, PubMed:22949645, PubMed:467643, PubMed:6319179, PubMed:9422791). The alpha chain is cleaved to generate C4a and C4b by MASP2 following activation by the lectin complement system (PubMed:11527969, PubMed:22691502, PubMed:22949645). The alpha chain is cleaved by GZMK to generate C4a and C4b following activation by the GZMK complement system (PubMed:39914456, PubMed:39814882). Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase (PubMed:3696167). The proteolytic cleavages often are incomplete so that many structural forms can be found in plasma (PubMed:3696167) Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens Ser-1236 of complement C4b interacts with complement C3b via a thioester linkage N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan
Involvement in disease Complement component 4A deficiency A rare defect of the complement classical pathway associated with the development of autoimmune disorders, mainly systemic lupus with or without associated glomerulonephritis. Systemic lupus erythematosus A chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow.
Keywords 3D-structure, Alternative splicing, Blood group antigen, Cell projection, Cleavage on pair of basic residues, Complement pathway, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Immunity, Inflammatory response, Innate immunity, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal, Sulfation, Synapse, Systemic lupus erythematosus, Thioester bond
Sequence MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTA FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVA LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL TLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ GCQV
UniProt accession: P0C0L4

Data

Human rejected kidney stained with anti-C4d antibody using peroxidase-conjugate and DAB chromogen. Note basement membrane/cytoplasmic staining of renal tubules.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the mouse anti-C4d monoclonal antibody (ZM78)?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. For the concentrated form, a dilution of 1:100 to 1:200 is recommended.

How should the mouse anti-C4d monoclonal antibody (ZM78) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.