Immunohistochemistry (IHC) : Human uterus stained with anti-SMA antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of smooth muscle.

mouse anti-Actin, Smooth Muscle (SMA) monoclonal antibody (1A4) 6012

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Actin, Smooth Muscle (SMA)
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Smooth muscle or leiomyosarcoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6012parent Categories: antibody, Zeta IHC antibodies Tags: Actin, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Actin, Smooth Muscle (SMA) monoclonal antibody 1A4 6012

antibody
Database link: human P62740
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Smooth muscle or leiomyosarcoma
Immunogen N-Terminal decapeptide of alpha smooth muscle isoform of actin; acetylated at the N-terminus
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Oryctolagus cuniculus ACTA2 Actin, aortic smooth muscle
Protein names Actin, aortic smooth muscle
Alternative names Alpha-actin-2
Gene names ACTA2
Protein family Belongs to the actin family
Function Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells
Catalytic activity ATP + H2O = ADP + phosphate + H(+)
Subcellular location Cytoplasm, cytoskeleton
Structure Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others
Post-translational modification N-terminal cleavage of acetylated cysteine of intermediate muscle actin by ACTMAP Oxidation of Met-46 and Met-49 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. MICAL1 and MICAL2 produce the (R)-S-oxide form. The (R)-S-oxide form is reverted by MSRB1 and MSRB2, which promotes actin repolymerization Monomethylation at Lys-86 (K84me1) regulates actin-myosin interaction and actomyosin-dependent processes. Demethylation by ALKBH4 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration (By similarity) Methylated at His-75 by SETD3
Keywords Acetylation, ATP-binding, Cytoplasm, Cytoskeleton, Hydrolase, Methylation, Muscle protein, Nucleotide-binding, Oxidation, Reference proteome
Sequence MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS KQEYDEAGPSIVHRKCF
UniProt accession: P62740

Data

Human uterus stained with anti-SMA antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of smooth muscle.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Actin, Smooth Muscle (SMA) monoclonal antibody (1A4) specifically react with?

This monoclonal antibody specifically reacts with human smooth muscle actin.

What are the recommended storage conditions for the mouse anti-Actin, Smooth Muscle (SMA) monoclonal antibody (1A4) to maintain its stability?

The antibody should be stored at 2-8°C for short term use and at -20°C for long term storage, while avoiding repeated freeze-thaw cycles to maintain stability.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.