| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody (HHF35) 6011
Price range: $160.00 through $528.00
Antibody summary
- Mouse monoclonal to Actin, Muscle Specific (MSA)
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG1
- Control: Skeletal muscle
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody HHF35 6011
| target relevance |
|---|
| Homo sapiens ACTC1 Actin, alpha cardiac muscle 1 |
| Protein names Actin, alpha cardiac muscle 1 |
| Alternative names Alpha-cardiac actin |
| Gene names ACTC1 |
| Protein family Belongs to the actin family |
| Function Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells |
| Catalytic activity ATP + H2O = ADP + phosphate + H(+) |
| Subcellular location Cytoplasm, cytoskeleton |
| Structure Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others |
| Post-translational modification Oxidation of Met-46 and Met-49 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. MICAL1 and MICAL2 produce the (R)-S-oxide form. The (R)-S-oxide form is reverted by MSRB1 and MSRB2, which promotes actin repolymerization Monomethylation at Lys-86 (K86me1) regulates actin-myosin interaction and actomyosin-dependent processes. Demethylation by ALKBH4 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration N-terminal cleavage of acetylated cysteine of intermediate muscle actin by ACTMAP Methylated at His-75 by SETD3 (Microbial infection) Monomeric actin is cross-linked by V.cholerae toxins RtxA and VgrG1 in case of infection: bacterial toxins mediate the cross-link between Lys-52 of one monomer and Glu-272 of another actin monomer, resulting in formation of highly toxic actin oligomers that cause cell rounding (PubMed:19015515). The toxin can be highly efficient at very low concentrations by acting on formin homology family proteins: toxic actin oligomers bind with high affinity to formins and adversely affect both nucleation and elongation abilities of formins, causing their potent inhibition in both profilin-dependent and independent manners (PubMed:26228148) |
| Involvement in disease Cardiomyopathy, dilated, 1R A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Cardiomyopathy, familial hypertrophic, 11 A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. Atrial septal defect 5 A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria. |
| Keywords 3D-structure, Acetylation, ATP-binding, Atrial septal defect, Cardiomyopathy, Cytoplasm, Cytoskeleton, Disease variant, Hydrolase, Isopeptide bond, Methylation, Muscle protein, Nucleotide-binding, Oxidation, Proteomics identification, Reference proteome |
| Sequence MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS KQEYDEAGPSIVHRKCF |
| UniProt accession: P68032 |
Data
![]() |
| Human uterus stained with anti-MSA antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of smooth muscle. |
FAQ & Publications
Frequently Asked Questions
What species is the mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody HHF35 validated to react with?
This antibody is validated for reactivity with human tissues, specifically for use in immunohistochemistry on formalin-fixed, paraffin-embedded human samples.
How should the mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.