Skip to content

mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody (HHF35) 6011

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Actin, Muscle Specific (MSA)
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1
  • Control: Skeletal muscle
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6011parent Categories: , Tags: ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody HHF35 6011

antibody
Database link:
human P68032
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Skeletal muscle
Immunogen
SDS extract of human myocardium
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 - Isotype Control
target relevance
Homo sapiens ACTC1
Actin, alpha cardiac muscle 1
Protein names
Actin, alpha cardiac muscle 1
Alternative names
Alpha-cardiac actin
Gene names
ACTC1
Protein family
Belongs to the actin family
Function
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells
Catalytic activity
ATP + H2O = ADP + phosphate + H(+)
Subcellular location
Cytoplasm, cytoskeleton
Structure
Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others
Post-translational modification
Oxidation of Met-46 and Met-49 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. MICAL1 and MICAL2 produce the (R)-S-oxide form. The (R)-S-oxide form is reverted by MSRB1 and MSRB2, which promotes actin repolymerization
Monomethylation at Lys-86 (K86me1) regulates actin-myosin interaction and actomyosin-dependent processes. Demethylation by ALKBH4 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration
N-terminal cleavage of acetylated cysteine of intermediate muscle actin by ACTMAP
Methylated at His-75 by SETD3
(Microbial infection) Monomeric actin is cross-linked by V.cholerae toxins RtxA and VgrG1 in case of infection: bacterial toxins mediate the cross-link between Lys-52 of one monomer and Glu-272 of another actin monomer, resulting in formation of highly toxic actin oligomers that cause cell rounding (PubMed:19015515). The toxin can be highly efficient at very low concentrations by acting on formin homology family proteins: toxic actin oligomers bind with high affinity to formins and adversely affect both nucleation and elongation abilities of formins, causing their potent inhibition in both profilin-dependent and independent manners (PubMed:26228148)
Involvement in disease
Cardiomyopathy, dilated, 1R
A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.

Cardiomyopathy, familial hypertrophic, 11
A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.

Atrial septal defect 5
A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria.

Keywords
3D-structure, Acetylation, ATP-binding, Atrial septal defect, Cardiomyopathy, Cytoplasm, Cytoskeleton, Disease variant, Hydrolase, Isopeptide bond, Methylation, Muscle protein, Nucleotide-binding, Oxidation, Proteomics identification, Reference proteome
Sequence
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS KQEYDEAGPSIVHRKCF
UniProt accession: P68032

Data

Human uterus stained with anti-MSA antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of smooth muscle.
Human uterus stained with anti-MSA antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of smooth muscle.

FAQ & Publications

Frequently Asked Questions
What species is the mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody HHF35 validated to react with?
This antibody is validated for reactivity with human tissues, specifically for use in immunohistochemistry on formalin-fixed, paraffin-embedded human samples.
How should the mouse anti-Actin, Muscle Specific (MSA) monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.