Skip to content

GFP ELISA Kit 50036

$570.00

Summary

  • GFP ELISA Kit
  • Benchmark antibodies Quick-Start Technology ™
  • Ready-to-use
  • 96 tests + 24 prediluted standards
SKU: 50036 Category: Tags: ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
target

GFP

species reactivity

Aequorea victoria, usually used as recombinant tag

applications

ELISA

assay type

direct & quantitative, Quick-start ELISA technology

available sizes

96 tests

GFP ELISA kit 50036

kit
Assay type
sandwich ELISA (direct measurement)
Research area
Recombinant expression
Sample type
cell lysates
Components
Component Description Storage of Opened Material
Coated Microplate for samples 96-well (12 strips x8) coated microplate Store at 2-8°C. Return unused wells to the foil pouch with desiccant.
Coated Microplate for standards 24-well (4 strips x8) coated microplate with calibrated standard series
Detector Reagent Enzyme-linked Detector
Capture Reagent Capture element with affinity for plate well
10X PBST Wash Buffer Concentrate Concentrated solution of buffered surfactant
Substrate Solution (TMB) Stabilized hydrogen peroxide and chromogen
Stop Solution 1N Sulfuric Acid
Plate Sealers Adhesive strips for incubation
/* Header styles */ .header-table { width: 100%; border-collapse: collapse; margin-bottom: 20px; } .header-table td { vertical-align: middle; padding: 0; } /* Content and list styles */ .content-table { width: 100%; border-collapse: collapse; } .content-table td { padding: 2px 4px; font-size: 0.8em; vertical-align: top; line-height: 1.5; } /* Table for kit contents and performance data */ /* Styles for the more compact table */ .compact-data-table { width: 100%; border-collapse: collapse; margin-top: 10px; } .compact-data-table th, .compact-data-table td { border: 1px solid #ddd; /* Key changes for compactness */ font-size: 0.7em; /* Smaller font */ padding: 4px 6px; /* Reduced padding */ line-height: 1.3; /* Tighter line spacing */ text-align: left; } .compact-data-table th { background-color: #f2f2f2; font-weight: 600; } .compact-data-table tbody tr:last-child td { border-bottom: 1px solid #ddd !important; /* or border-bottom: none; */ } .compact-data-table td[rowspan] { border-bottom: 1px solid #ddd !important; }
Storage
Store at 2-8°C.
Associated products
Human IgG Quickstart ELISA Kit (50030)
Mouse IgG Quickstart ELISA Kit (50032)
Chicken IgY Quickstart ELISA Kit (50033)
Rabbit IgG Quickstart ELISA Kit(50034)
Goat IgG Quickstart ELISA Kit (50035)
GFP Quickstart ELISA Kit (50036)
Human TNFA Quickstart ELISA Kit (50037)
target relevance
Aequorea victoria GFP
Green fluorescent protein
Protein names
Green fluorescent protein
Gene names
GFP
Protein family
Belongs to the GFP family
Function
Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin
Structure
Monomer
Post-translational modification
Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen
Keywords
3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein
Sequence
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
UniProt accession: P42212

Data

FAQ & Publications

Frequently Asked Questions
What species is the GFP ELISA Kit 50036 reactive to?
The GFP ELISA Kit 50036 is reactive to GFP derived from Aequorea victoria, commonly used as a recombinant tag.
What sample types can be analyzed using this GFP ELISA Kit?
This kit is designed for use with cell lysate samples for the direct quantitative measurement of GFP.
How should the GFP ELISA Kit 50036 be stored to maintain stability?
The kit components should be stored at 2-8°C to preserve reagent integrity and functionality.
What assay format does the GFP ELISA Kit 50036 employ and what does it measure?
The kit utilizes a sandwich ELISA format with Quick-start technology for direct and quantitative measurement of GFP protein levels.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
5003x Short Protocol protocol
5003x Full Protocol protocol

Documents

#
Please enter your product and batch number here.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.