| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| target | GFP |
| species reactivity | Aequorea victoria, usually used as recombinant tag |
| applications | ELISA |
| assay type | direct & quantitative, Quick-start ELISA technology |
| available sizes | 96 tests |
GFP ELISA Kit 50036
$570.00
Summary
- GFP ELISA Kit
- Benchmark antibodies Quick-Start Technology ™
- Ready-to-use
- 96 tests + 24 prediluted standards
GFP ELISA kit 50036
| kit | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Assay type sandwich ELISA (direct measurement) | ||||||||||||||||||||
| Research area Recombinant expression | ||||||||||||||||||||
| Sample type cell lysates | ||||||||||||||||||||
Components
| ||||||||||||||||||||
| Storage Store at 2-8°C. | ||||||||||||||||||||
| Associated products Human IgG Quickstart ELISA Kit (50030) Mouse IgG Quickstart ELISA Kit (50032) Chicken IgY Quickstart ELISA Kit (50033) Rabbit IgG Quickstart ELISA Kit(50034) Goat IgG Quickstart ELISA Kit (50035) GFP Quickstart ELISA Kit (50036) Human TNFA Quickstart ELISA Kit (50037) |
| target relevance |
|---|
| Aequorea victoria GFP Green fluorescent protein |
| Protein names Green fluorescent protein |
| Gene names GFP |
| Protein family Belongs to the GFP family |
| Function Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin |
| Structure Monomer |
| Post-translational modification Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Ser-65 and Gly-67, and oxidation of Tyr-66 to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen |
| Keywords 3D-structure, Chromophore, Direct protein sequencing, Luminescence, Photoprotein |
| Sequence MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK |
| UniProt accession: P42212 |
Data
FAQ & Publications
Frequently Asked Questions
What species is the GFP ELISA Kit 50036 reactive to?
The GFP ELISA Kit 50036 is reactive to GFP derived from Aequorea victoria, commonly used as a recombinant tag.
What sample types can be analyzed using this GFP ELISA Kit?
This kit is designed for use with cell lysate samples for the direct quantitative measurement of GFP.
How should the GFP ELISA Kit 50036 be stored to maintain stability?
The kit components should be stored at 2-8°C to preserve reagent integrity and functionality.
What assay format does the GFP ELISA Kit 50036 employ and what does it measure?
The kit utilizes a sandwich ELISA format with Quick-start technology for direct and quantitative measurement of GFP protein levels.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| 5003x Short Protocol protocol 5003x Full Protocol protocol |
Only logged in customers who have purchased this product may leave a review.






Reviews
There are no reviews yet.