Skip to content

Human TNFA ELISA Kit 50037

$570.00

Summary

  • Human TNFA ELISA Kit
  • Benchmark antibodies Quick-Start Technology ™
  • Ready-to-use
  • 96 tests + 24 prediluted standards
SKU: 50037 Category: Tags: ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
target

TNFA

species reactivity

Human

applications

ELISA

assay type

direct & quantitative, Quick-start ELISA technology

available sizes

96 tests

Human TNFA ELISA kit 50037

kit
Assay type
sandwich ELISA (direct measurement)
Research area
Cytokines
Sample type
Serum, plasma, whole blood
Components
Component Description Storage of Opened Material
Coated Microplate for samples 96-well (12 strips x8) coated microplate Store at 2-8°C. Return unused wells to the foil pouch with desiccant.
Coated Microplate for standards 24-well (4 strips x8) coated microplate with calibrated standard series
Detector Reagent Enzyme-linked Detector
Capture Reagent Capture element with affinity for plate well
10X PBST Wash Buffer Concentrate Concentrated solution of buffered surfactant
Substrate Solution (TMB) Stabilized hydrogen peroxide and chromogen
Stop Solution 1N Sulfuric Acid
Plate Sealers Adhesive strips for incubation
/* Header styles */ .header-table { width: 100%; border-collapse: collapse; margin-bottom: 20px; } .header-table td { vertical-align: middle; padding: 0; } /* Content and list styles */ .content-table { width: 100%; border-collapse: collapse; } .content-table td { padding: 2px 4px; font-size: 0.8em; vertical-align: top; line-height: 1.5; } /* Table for kit contents and performance data */ /* Styles for the more compact table */ .compact-data-table { width: 100%; border-collapse: collapse; margin-top: 10px; } .compact-data-table th, .compact-data-table td { border: 1px solid #ddd; /* Key changes for compactness */ font-size: 0.7em; /* Smaller font */ padding: 4px 6px; /* Reduced padding */ line-height: 1.3; /* Tighter line spacing */ text-align: left; } .compact-data-table th { background-color: #f2f2f2; font-weight: 600; } .compact-data-table tbody tr:last-child td { border-bottom: 1px solid #ddd !important; /* or border-bottom: none; */ } .compact-data-table td[rowspan] { border-bottom: 1px solid #ddd !important; }
Storage
Store at 2-8°C.
Associated products
Human IgG Quickstart ELISA Kit (50030)
Mouse IgG Quickstart ELISA Kit (50032)
Chicken IgY Quickstart ELISA Kit (50033)
Rabbit IgG Quickstart ELISA Kit(50034)
Goat IgG Quickstart ELISA Kit (50035)
GFP Quickstart ELISA Kit (50036)
Human TNFA Quickstart ELISA Kit (50037)
target relevance
Homo sapiens TNF
Tumor necrosis factor
Protein names
Tumor necrosis factor
Alternative names
Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2
Gene names
TNF
Protein family
Belongs to the tumor necrosis factor family
Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:16829952, PubMed:22517918, PubMed:23396208). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 (PubMed:12794819). Promotes osteoclastogenesis and therefore mediates bone resorption (By similarity)
Subcellular location
Secreted
Structure
Homotrimer. Interacts with SPPL2B
Post-translational modification
The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space
The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1
O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid
The soluble form is demyristoylated at Lys-19 and Lys-20 by SIRT6, promoting its secretion
Involvement in disease
Psoriatic arthritis
An inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoid like pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).

Immunodeficiency 127
An autosomal recessive immunologic disorder characterized by increased susceptibility to pulmonary infection with Mycobacterium tuberculosis. Affected individuals develop recurrent pulmonary tuberculosis, but have no adverse reaction to live BCG vaccination.

Keywords
3D-structure, Cell membrane, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Lipoprotein, Membrane, Myristate, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal-anchor, Transmembrane, Transmembrane helix
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
UniProt accession: P01375

Data

FAQ & Publications

Frequently Asked Questions
What sample types are compatible with the Human TNFA ELISA Kit 50037?
The Human TNFA ELISA Kit 50037 is compatible with serum, plasma, and whole blood samples for quantitative analysis of human TNFA.
How should the Human TNFA ELISA Kit 50037 be stored to maintain stability?
The kit components should be stored at 2-8°C to ensure proper stability and performance during use.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
5003x Short Protocol protocol
5003x Full Protocol protocol

Documents

#
Please enter your product and batch number here.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.