Immunohistochemistry (IHC) : Human basal cell carcinoma stained with anti-keratin 8 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

mouse anti-Cytokeratin 8 monoclonal antibody (ZM123) 6151

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cytokeratin 8
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Breast carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6151parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 8, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cytokeratin 8 monoclonal antibody ZM123 6151

antibody
Database link: human P05787
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast carcinoma
Immunogen Recombinant full-length human KRT8 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens KRT8 Keratin, type II cytoskeletal 8
Protein names Keratin, type II cytoskeletal 8
Alternative names Cytokeratin-8, Keratin-8, Type-II keratin Kb8
Gene names KRT8
Protein family Belongs to the intermediate filament family
Function Required for the formation of KRT8/KRT18 filaments that are involved in ARHGEF40-mediated actin stress fiber formation and tensional force-induced stress fiber formation and reinforcement (PubMed:26823019). Together with KRT19, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle
Subcellular location Cytoplasm, Nucleus, nucleoplasm, Nucleus matrix, Cytoplasm, cytoskeleton
Structure (Microbial infection) Interacts with hepatitis C virus/HCV core protein
Post-translational modification Phosphorylation on serine residues is enhanced during EGF stimulation and mitosis. Ser-74 phosphorylation plays an important role in keratin filament reorganization O-glycosylated. O-GlcNAcylation at multiple sites increases solubility, and decreases stability by inducing proteasomal degradation O-glycosylated (O-GlcNAcylated), in a cell cycle-dependent manner
Involvement in disease Cirrhosis A liver disease characterized by severe panlobular liver-cell swelling with Mallory body formation, prominent pericellular fibrosis, and marked deposits of copper. Clinical features include abdomen swelling, jaundice and pulmonary hypertension.
Keywords 3D-structure, Acetylation, Alternative splicing, Coiled coil, Cytoplasm, Cytoskeleton, Direct protein sequencing, Disease variant, Glycoprotein, Host-virus interaction, Intermediate filament, Isopeptide bond, Keratin, Methylation, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGM GGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLE TKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYE DEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDL RRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAAL QRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYA GGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV LPK
UniProt accession: P05787

Data

Human basal cell carcinoma stained with anti-keratin 8 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for the mouse anti-Cytokeratin 8 monoclonal antibody (ZM123) when used in immunohistochemistry?

For immunohistochemistry applications, the concentrated mouse anti-Cytokeratin 8 monoclonal antibody (ZM123) is recommended to be diluted between 1:100 and 1:200.

Which species does the mouse anti-Cytokeratin 8 antibody specifically react with, and what is a suitable positive control tissue?

This antibody specifically reacts with human Cytokeratin 8. Breast carcinoma tissue is recommended as a positive control for validating staining.

What are the storage conditions recommended for maintaining the stability of the mouse anti-Cytokeratin 8 monoclonal antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.