| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | DFF40/CAD (IN) |
| available sizes | 100 µg |
rabbit anti-DFF40 (IN) polyclonal antibody 8407
$445.00
Antibody summary
- Rabbit polyclonal to DFF40 (IN)
- Suitable for: ELISA,WB,ICC
- Isotype: IgG
- 100 µg
rabbit anti-DFF40 (IN) polyclonal antibody 8407
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1-2ug/mL. Immunocytochemistry: use at 10ug/mL. Positive control: Whole cell lysate of Jurkat cells. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 203-218 of human DFF40 (accession no. NP_004393). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus DFFB DNA fragmentation factor subunit beta |
| Protein names DNA fragmentation factor subunit beta |
| Alternative names Caspase-activated deoxyribonuclease, DNA fragmentation factor 40 kDa subunit |
| Gene names Dffb |
| Function Nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. Degrades naked DNA and induces apoptotic morphology |
| Subcellular location Cytoplasm, Nucleus |
| Structure Heterodimer of DFFA and DFFB (By similarity). Interacts with H1-1 (By similarity) |
| Keywords 3D-structure, Apoptosis, Cytoplasm, Hydrolase, Nuclease, Nucleus, Reference proteome |
| Sequence MCAVLRQPKCVKLRALHSACKFGVAARSCQELLRKGCVRFQLPMPGSRLCLYEDGTEVTD DCFPGLPNDAELLLLTAGETWHGYVSDITRFLSVFNEPHAGVIQAARQLLSDEQAPLRQK LLADLLHHVSQNITAETREQDPSWFEGLESRFRNKSGYLRYSCESRIRGYLREVSAYTSM VDEAAQEEYLRVLGSMCQKLKSVQYNGSYFDRGAEASSRLCTPEGWFSCQGPFDLESCLS KHSINPYGNRESRILFSTWNLDHIIEKKRTVVPTLAEAIQDGREVNWEYFYSLLFTAENL KLVHIACHKKTTHKLECDRSRIYRPQTGSRRKQPARKKRPARKR |
| UniProt accession: O54788 |
Data
 |
| Western blot analysis of DFF40 in (A) K562 and (B) and Jurkat cell lysate with DFF40 antibody at 1 µg/mL. |
 |
| Immunocytochemistry of DFF40 in K562 cells with DFF40 antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and dilution ranges for the rabbit anti-DFF40 (IN) polyclonal antibody 8407?
This antibody is suitable for ELISA, Western blotting (WB), and immunocytochemistry (ICC/IF). Recommended dilutions are 1-2 µg/mL for immunoblotting and 10 µg/mL for immunocytochemistry. Users should optimize concentrations for their specific experimental conditions.
How should the rabbit anti-DFF40 (IN) polyclonal antibody be stored to maintain its stability?
The antibody is provided in liquid form at a concentration of 1 mg/mL in PBS buffer (pH 7.4). It is stable for at least one year when stored at -20°C. To preserve antibody integrity, avoid multiple freeze-thaw cycles.
What is the immunogen used to generate this rabbit polyclonal antibody against DFF40?
The immunogen is a peptide corresponding to amino acids 203-218 of the human DFF40 protein (accession number NP_004393).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.