Immunohistochemistry (IHC) : Human placenta stained with anti-PLAP antibody using peroxidase-conjugate and DAB chromogen. Note the membrane staining of trophoblasts..

rabbit anti-PLAP monoclonal antibody (ZR441) 6338

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PLAP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Placenta
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6338parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gynecological Pathology, monoclonal, PLAP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PLAP monoclonal antibody ZR441 6338

antibody
Database link: human P05187
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Placenta
Immunogen Recombinant full-length human ALPP protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens ALPP Alkaline phosphatase, placental type
Protein names Alkaline phosphatase, placental type
Alternative names Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1
Gene names ALPP
Protein family Belongs to the alkaline phosphatase family
Function Alkaline phosphatase that can hydrolyze various phosphate compounds
Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate
Subcellular location Cell membrane
Structure Homodimer
Keywords 3D-structure, Calcium, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, GPI-anchor, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Zinc
Sequence MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
UniProt accession: P05187

Data

Human placenta stained with anti-PLAP antibody using peroxidase-conjugate and DAB chromogen. Note the membrane staining of trophoblasts..

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PLAP monoclonal antibody (ZR441) specifically react with?

This antibody is reactive with human species, making it suitable for human tissue analysis.

What are the recommended storage conditions for maintaining the stability of the rabbit anti-PLAP monoclonal antibody (ZR441)?

For short-term storage, keep the antibody at 2-8°C, and for long-term preservation, store it at -20°C while avoiding repeated freeze/thaw cycles.

Which applications is the rabbit anti-PLAP monoclonal antibody (ZR441) validated for, and what control tissue is recommended?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with human placenta recommended as a positive control tissue.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.