| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-PLAP monoclonal antibody (ZR441) 6338
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to PLAP
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Placenta
- Visualization: Membrane
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-PLAP monoclonal antibody ZR441 6338
| target relevance |
|---|
| Homo sapiens ALPP Alkaline phosphatase, placental type |
| Protein names Alkaline phosphatase, placental type |
| Alternative names Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1 |
| Gene names ALPP |
| Protein family Belongs to the alkaline phosphatase family |
| Function Alkaline phosphatase that can hydrolyze various phosphate compounds |
| Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate |
| Subcellular location Cell membrane |
| Structure Homodimer |
| Keywords 3D-structure, Calcium, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, GPI-anchor, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Zinc |
| Sequence MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP |
| UniProt accession: P05187 |
Data
![]() |
| Human placenta stained with anti-PLAP antibody using peroxidase-conjugate and DAB chromogen. Note the membrane staining of trophoblasts.. |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-PLAP monoclonal antibody (ZR441) specifically react with?
This antibody is reactive with human species, making it suitable for human tissue analysis.
What are the recommended storage conditions for maintaining the stability of the rabbit anti-PLAP monoclonal antibody (ZR441)?
For short-term storage, keep the antibody at 2-8°C, and for long-term preservation, store it at -20°C while avoiding repeated freeze/thaw cycles.
Which applications is the rabbit anti-PLAP monoclonal antibody (ZR441) validated for, and what control tissue is recommended?
This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with human placenta recommended as a positive control tissue.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

















Reviews
There are no reviews yet.