Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human complete moles stained with anti-p57 antibody

rabbit anti-p57Kip2 monoclonal antibody (ZR230) 6314

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to p57Kip2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon carcinoma or placenta
Visualization: Nucleus
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6314parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gynecological Pathology, monoclonal, p57Kip2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-p57Kip2 monoclonal antibody ZR230 6314

antibody
Database link: human P49918
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma or placenta
Immunogen Recombinant full-length human p57Kip2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CDKN1C Cyclin-dependent kinase inhibitor 1C
Protein names Cyclin-dependent kinase inhibitor 1C
Alternative names Cyclin-dependent kinase inhibitor p57, p57Kip2
Gene names CDKN1C
Protein family Belongs to the CDI family
Function Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life
Subcellular location Nucleus
Structure Interacts with PCNA
Involvement in disease Beckwith-Wiedemann syndrome A disorder characterized by anterior abdominal wall defects including exomphalos (omphalocele), pre- and postnatal overgrowth, and macroglossia. Additional less frequent complications include specific developmental defects and a predisposition to embryonal tumors. Intrauterine growth retardation, metaphyseal dysplasia, adrenal hypoplasia congenita, and genital anomalies A rare condition characterized by intrauterine growth restriction, metaphyseal dysplasia, congenital adrenal hypoplasia, and genital anomalies. Patients with this condition may present shortly after birth with severe adrenal insufficiency, which can be life-threatening if not recognized early and commenced on steroid replacement therapy. Other reported features in this condition include, hypercalciuria and/or hypercalcemia, craniosynostosis, cleft palate, and scoliosis.
Keywords Alternative splicing, Cell cycle, Disease variant, Methylation, Nucleus, Phosphoprotein, Protein kinase inhibitor, Proteomics identification, Reference proteome, Repeat, Tumor suppressor
Sequence MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR
UniProt accession: P49918

Data

Formalin-fixed, paraffin-embedded human complete moles stained with anti-p57 antibody

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-p57Kip2 monoclonal antibody (ZR230) specifically react with?

This antibody is reactive with human species, making it suitable for studies involving human tissue samples.

For which applications is the rabbit anti-p57Kip2 monoclonal antibody (ZR230) recommended?

It is recommended for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-p57Kip2 monoclonal antibody (ZR230) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this antibody in IHC?

The concentrated antibody is recommended to be diluted between 1:100 and 1:200 for optimal immunohistochemical staining.

What is the host species and clonality of the anti-p57Kip2 antibody (ZR230)?

This antibody is a rabbit monoclonal antibody, providing high specificity and affinity for the p57Kip2 target.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.