Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human cerebrum stained with anti-NeuN antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of granular neuronal cells

rabbit anti-NeuN monoclonal antibody (ZR386) 6285

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to NeuN
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Brain tissue
Visualization: Nuclear and cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6285parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, NeuN, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-NeuN monoclonal antibody ZR386 6285

antibody
Database link: human A6NFN3
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Brain tissue
Immunogen Recombinant fragment (around aa1-200) of human RBFOX3 (NeuN) protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens RBFOX3 RNA binding protein fox-1 homolog 3
Protein names RNA binding protein fox-1 homolog 3
Alternative names Fox-1 homolog C, Neuronal nuclei antigen
Gene names RBFOX3
Function Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD)
Subcellular location Nucleus, Cytoplasm
Keywords Alternative splicing, Cytoplasm, Methylation, mRNA processing, mRNA splicing, Nucleus, Proteomics identification, Reference proteome, RNA-binding
Sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGS EASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFG QFGKILDVEIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTN KKTGNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRA APPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHT IGPAATYSIGTM
UniProt accession: A6NFN3

Data

Formalin-fixed, paraffin-embedded human cerebrum stained with anti-NeuN antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of granular neuronal cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-NeuN monoclonal antibody (ZR386) specifically react with?

This antibody specifically reacts with human NeuN protein.

Which sample types and applications is this antibody validated for?

The rabbit anti-NeuN monoclonal antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with brain tissue recommended as a positive control.

How should the rabbit anti-NeuN monoclonal antibody (ZR386) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze at -20°C while avoiding repeated freeze/thaw cycles.

What forms and concentrations are available for the rabbit anti-NeuN monoclonal antibody (ZR386)?

The antibody is available in concentrated forms of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.