Weight | 1 lbs |
---|---|
Dimensions | 9 × 5 × 2 in |
accession | Q9NRJ3 |
express system | E.coli |
product tag | none |
purity | > 97% by SDS PAGE |
molecular weight | Predicted Molecular Mass: 12.031 kDa Extinction Coefficient: 8,970 M-1 cm-1 Actual Molecular Mass: 12.031kDa by ESI Mass Spec |
available size | 100 µg, 1mg, 20 µg, 5 µg, 50 µg |
endotoxin | <0.01 EU per 1μg of the protein by the LAL method |
sequence | ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVK QWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Mucosae-associated epithelial chemokine (MEC/CCL28) 8012
$61.00 – $2,189.00
Summary
- Expression: E.coli
- Amino Acid Range: 23-127
Mucosae-associated epithelial chemokine (MEC/CCL28) 8012
protein |
---|
Database link: human Q9NRJ3 |
Size and concentration 5, 20, 50, 100, 1000µg and lyophilized |
Form Lyophilized |
Storage Instructions Avoid repeated freeze-thaw cycles: • 12 months from date of receipt, -20 to -70 °C as supplied. • 1 month, 2 to 8 °C under sterile conditions after reconstitution. • 3 months, -20 to -70 °C under sterile conditions after reconstitution |
Storage buffer Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water. Shipping: Room Temp |
Purity > 97% by SDS PAGE and HPLC |
target relevance |
---|
Mucosae-associated epithelial chemokine (MEC/CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infection. |
Protein names C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28) |
Protein family 457 |
Function Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. |
Pathway 351 |
Subellular location Secreted. |
Tissues Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin. |
Target Relevance information above includes information from UniProt accession: Q9NRJ3 |
The UniProt Consortium |
Data
Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells. |
Publications
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.pmid | title | authors | citation |
---|
Protocols
relevant to this product |
---|
Migration assay |
Documents
# | ||
---|---|---|
Please enter your product and batch number here to retrieve - product datasheet, SDS, and QC information. |
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.