Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells.

Mucosae-associated epithelial chemokine (MEC/CCL28) 8012

$61.00 – $2,189.00

Summary

Expression: E.coli
Amino Acid Range: 23-127

available size

Clear

SKU: 8012parent Categories: chemokine, proteins Tag: CCL28 (MEC)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
accession	Q9NRJ3
express system	E.coli
product tag	none
purity	> 97% by SDS PAGE
molecular weight	Predicted Molecular Mass: 12.031 kDa Extinction Coefficient: 8,970 M-1 cm-1 Actual Molecular Mass: 12.031kDa by ESI Mass Spec
available size	100 µg, 1mg, 20 µg, 5 µg, 50 µg
endotoxin	<0.01 EU per 1μg of the protein by the LAL method
sequence	ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVK QWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY

Mucosae-associated epithelial chemokine (MEC/CCL28) 8012

protein
Database link:
human Q9NRJ3
Size and concentration
5, 20, 50, 100, 1000µg and lyophilized
Form
Lyophilized
Storage Instructions
Avoid repeated freeze-thaw cycles:
• 12 months from date of receipt, -20 to -70 °C as supplied.
• 1 month, 2 to 8 °C under sterile conditions after reconstitution.
• 3 months, -20 to -70 °C under sterile conditions after reconstitution
Storage buffer
?Reconstitution: Spin sample prior to reconstitution. Recommended concentration of 100µg/mL in sterile water.
Shipping: Room Temp
Purity
> 97% by SDS PAGE and HPLC
target relevance
Mucosae-associated epithelial chemokine (MEC/CCL28) is secreted by epithelial cells of gastrointestinal and nonintestinal mucosal cells, and regulates chemotaxis of cells expressing surface receptors CCR3 and CCR10. It shows broad-spectrum antibacterial activities, and could also be useful in vaccination of HIV infection.
Protein names
C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)
Protein family
457
Function
Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
Pathway
351
Subellular location
Secreted.
Tissues
Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
Target Relevance information above includes information from UniProt accession: Q9NRJ3
The UniProt Consortium

Data

Migration Assay: Cells expressing recombinant CCR10 were assayed for migration through a transwell filter at various concentrations of MEC. Responses are expressed as the % of total input cells.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from PubMed database provided by The United States National Library of Medicine at the National Institutes of Health.