Skip to content

mouse anti-Tumor Necrosis Factor α monoclonal antibody (F6C5) 9153

$314.00

Antibody summary

  • Mouse monoclonal to Tumor Necrosis Factor α
  • Suitable for: ELISA,IHC
  • Isotype: IgG1
  • 200 µg
SKU: 9153parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Tumor Necrosis Factorα

available sizes

200 µg

mouse anti-Tumor Necrosis Factor α monoclonal antibody (F6C5) 9153

antibody
Tested applications
IHC,IHC,ELISA
Recommended dilutions
These antibodies may be used in immunoassays or in immunohisto- chemistry to detect and/or quantitate TNFa. 21301 and 21302 may be used in biological assays to inhibit activity of TNFa. Other applications are under investigation.
Immunogen
Recombinant human TNFa.
Size and concentration
200µg and lot specific
Form
liquid
Storage Instructions
These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles.
Storage buffer
PBS containing 0.1% NaN3
Purity
protein affinity purification
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG1 - Isotype Control
target relevance
Homo sapiens TNF
Tumor necrosis factor
Protein names
Tumor necrosis factor
Alternative names
Cachectin, TNF-alpha, Tumor necrosis factor ligand superfamily member 2
Gene names
TNF
Protein family
Belongs to the tumor necrosis factor family
Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs regulatory T-cells (Treg) function in individuals with rheumatoid arthritis via FOXP3 dephosphorylation. Up-regulates the expression of protein phosphatase 1 (PP1), which dephosphorylates the key 'Ser-418' residue of FOXP3, thereby inactivating FOXP3 and rendering Treg cells functionally defective (PubMed:23396208). Key mediator of cell death in the anticancer action of BCG-stimulated neutrophils in combination with DIABLO/SMAC mimetic in the RT4v6 bladder cancer cell line (PubMed:16829952, PubMed:22517918, PubMed:23396208). Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance (By similarity). Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6 (PubMed:12794819). Promotes osteoclastogenesis and therefore mediates bone resorption (By similarity)
Subcellular location
Secreted
Structure
Homotrimer. Interacts with SPPL2B
Post-translational modification
The soluble form derives from the membrane form by proteolytic processing. The membrane-bound form is further proteolytically processed by SPPL2A or SPPL2B through regulated intramembrane proteolysis producing TNF intracellular domains (ICD1 and ICD2) released in the cytosol and TNF C-domain 1 and C-domain 2 secreted into the extracellular space
The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1
O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid
The soluble form is demyristoylated at Lys-19 and Lys-20 by SIRT6, promoting its secretion
Involvement in disease
Psoriatic arthritis
An inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoid like pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis).

Immunodeficiency 127
An autosomal recessive immunologic disorder characterized by increased susceptibility to pulmonary infection with Mycobacterium tuberculosis. Affected individuals develop recurrent pulmonary tuberculosis, but have no adverse reaction to live BCG vaccination.

Keywords
3D-structure, Cell membrane, Cytokine, Direct protein sequencing, Disulfide bond, Glycoprotein, Lipoprotein, Membrane, Myristate, Phosphoprotein, Proteomics identification, Reference proteome, Secreted, Signal-anchor, Transmembrane, Transmembrane helix
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
UniProt accession: P01375

Data

No results found

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-Tumor Necrosis Factor α monoclonal antibody (F6C5) suitable for?
This antibody is suitable for ELISA and immunohistochemistry (IHC) applications. It has also been tested for use in immunocytochemistry/immunofluorescence (ICC/IF) and Western blot (WB) assays.
How should the mouse anti-Tumor Necrosis Factor α monoclonal antibody be stored to maintain stability?
The antibody should be stored at temperatures between -20°C and -70°C. It is recommended to aliquot the product to avoid multiple freeze-thaw cycles, ensuring stability for at least one year.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.