| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Transglutaminase-3 (TG3) |
| available sizes | 100 µg |
mouse anti-Transglutaminase-3 (TG3) monoclonal antibody (C2D) 7739
$520.00
Antibody summary
- Mouse monoclonal to Transglutaminase-3 (TG3)
- Suitable for: WB,ICC,IHC
- Isotype: IgG1
- 100 µg
mouse anti-Transglutaminase-3 (TG3) monoclonal antibody (C2D) 7739
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting: use at 1-5ug/mL. Bands of ~77kDa and ~30kDa are detected. Immunocytochemistry: use at 2-10ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Recombinant human TG3 (accession no. Q08188). |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens TGM3 Protein-glutamine gamma-glutamyltransferase E |
| Protein names Protein-glutamine gamma-glutamyltransferase E |
| Alternative names Transglutaminase E, Transglutaminase-3 |
| Gene names TGM3 |
| Protein family Belongs to the transglutaminase superfamily. Transglutaminase family |
| Function Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath |
| Catalytic activity L-glutaminyl-[protein] + L-lysyl-[protein] = [protein]-L-lysyl-N(6)-5-L-glutamyl-[protein] + NH4(+) |
| Subcellular location Cytoplasm |
| Structure Consists of two polypeptide chains, which are synthesized as a precursor form of a single polypeptide |
| Post-translational modification Activated by proteolytic processing. In vitro activation is commonly achieved by cleavage with dispase, a neutral bacterial protease. Dispase cleavage site was proposed to lie between Ser-470 and Ser-471 (PubMed:8099584) or between Pro-465 and Phe-466 (PubMed:16565075). Physiological activation may be catalyzed by CTSL and, to a lesser extent, by CTSS, but not by CTSB, CTSD nor CTSV (PubMed:16565075) |
| Involvement in disease Uncombable hair syndrome 2 A form of uncombable hair syndrome, a condition characterized by scalp hair that is impossible to comb due to the haphazard arrangement of the hair bundles. A characteristic morphologic feature is a triangular to reniform to heart shape on cross-sections, and a groove, canal or flattening along the entire length of the hair. Most individuals are affected early in childhood and the hair takes on a spun-glass appearance with the hair becoming dry, curly, glossy, lighter in color, and progressively uncombable. The hair growth rate can range from slow to normal, and the condition improves with age. |
| Keywords 3D-structure, Acetylation, Acyltransferase, Calcium, Cytoplasm, Direct protein sequencing, Keratinization, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Zymogen |
| Sequence MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSNERLEFIVST GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTISISSPASAPIGRYTMALQIFSQ GGISSVKLGTFILLFNPWLNVDSVFMGNHAEREEYVQEDAGIIFVGSTNRIGMIGWNFGQ FEEDILSICLSILDRSLNFRRDAATDVASRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT YTGGRDPRSWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER SQGVFQCGPASVIGVREGDVQLNFDMPFIFAEVNADRITWLYDNTTGKQWKNSVNSHTIG RYISTKAVGSNARMDVTDKYKYPEGSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQE PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSAT MSLDPEEEAEHPIKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDIILDNPTLTLE VLNEARVRKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLGPKEGSRVRFD ILPSRSGTKQLLADFSCNKFPAIKAMLSIDVAE |
| UniProt accession: Q08188 |
Data
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Transglutaminase-3 (TG3) monoclonal antibody (C2D) been validated for?
This antibody has been tested and is suitable for Western blotting (WB), immunohistochemistry (IHC), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the mouse anti-Transglutaminase-3 (TG3) monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable for at least one year when stored at -20°C to -70°C. After reconstitution, it should be aliquoted and stored to avoid repeated freeze-thaw cycles.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.