| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG3 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Transglutaminase-2 (TG2) |
| available sizes | 100 µg |
mouse anti-Transglutaminase-2 (TG2) monoclonal antibody (7D2) 4432
$520.00
Antibody summary
- Mouse monoclonal to Transglutaminase-2 (TG2)
- Suitable for: WB,ICC
- Isotype: IgG3
- 100 µg
mouse anti-Transglutaminase-2 (TG2) monoclonal antibody (7D2) 4432
| antibody |
|---|
| Tested applications WB,ICC/IF |
| Recommended dilutions Immunoblotting: use at 1-5ug/mL. A band of ~80kDa is detected. Immunocytochemistry: use at 2- 10ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Purified TG2 from guinea pig liver (accession no. P21980). |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product is stable for at least one (1) year at -20°C to -70°C. Reconstituted product should be stored in appropriate aliquots to avoid repeated freeze-thaw cycles. |
| Storage buffer Lyophilized, 0.1M Tris, 0.1M glycine, 2% sucrose |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG3 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG3 - Isotype Control |
| target relevance |
|---|
| Homo sapiens TGM2 Protein-glutamine gamma-glutamyltransferase 2 |
| Protein names Protein-glutamine gamma-glutamyltransferase 2 |
| Alternative names Erythrocyte transglutaminase, Heart G alpha(h), Isopeptidase TGM2, Protein G alpha(h), Protein-glutamine deamidase TGM2, Protein-glutamine dopaminyltransferase TGM2, Protein-glutamine histaminyltransferase TGM2, Protein-glutamine noradrenalinyltransferase TGM2, Protein-glutamine serotonyltransferase TGM2, Tissue transglutaminase, Transglutaminase C, Transglutaminase H, Transglutaminase II, Transglutaminase-2 |
| Gene names TGM2 |
| Protein family Belongs to the transglutaminase superfamily. Transglutaminase family |
| Function Calcium-dependent acyltransferase that catalyzes the formation of covalent bonds between peptide-bound glutamine and various primary amines, such as gamma-amino group of peptide-bound lysine, or mono- and polyamines, thereby producing cross-linked or aminated proteins, respectively (PubMed:23941696, PubMed:31991788, PubMed:9252372). Involved in many biological processes, such as bone development, angiogenesis, wound healing, cellular differentiation, chromatin modification and apoptosis (PubMed:1683874, PubMed:27270573, PubMed:28198360, PubMed:7935379, PubMed:9252372). Acts as a protein-glutamine gamma-glutamyltransferase by mediating the cross-linking of proteins, such as ACO2, HSPB6, FN1, HMGB1, RAP1GDS1, SLC25A4/ANT1, SPP1 and WDR54 (PubMed:23941696, PubMed:24349085, PubMed:29618516, PubMed:30458214). Under physiological conditions, the protein cross-linking activity is inhibited by GTP; inhibition is relieved by Ca(2+) in response to various stresses (PubMed:18092889, PubMed:7592956, PubMed:7649299). When secreted, catalyzes cross-linking of proteins of the extracellular matrix, such as FN1 and SPP1 resulting in the formation of scaffolds (PubMed:12506096). Plays a key role during apoptosis, both by (1) promoting the cross-linking of cytoskeletal proteins resulting in condensation of the cytoplasm, and by (2) mediating cross-linking proteins of the extracellular matrix, resulting in the irreversible formation of scaffolds that stabilize the integrity of the dying cells before their clearance by phagocytosis, thereby preventing the leakage of harmful intracellular components (PubMed:7935379, PubMed:9252372). In addition to protein cross-linking, can use different monoamine substrates to catalyze a vast array of protein post-translational modifications: mediates aminylation of serotonin, dopamine, noradrenaline or histamine into glutamine residues of target proteins to generate protein serotonylation, dopaminylation, noradrenalinylation or histaminylation, respectively (PubMed:23797785, PubMed:30867594). Mediates protein serotonylation of small GTPases during activation and aggregation of platelets, leading to constitutive activation of these GTPases (By similarity). Plays a key role in chromatin organization by mediating serotonylation and dopaminylation of histone H3 (PubMed:30867594, PubMed:32273471). Catalyzes serotonylation of 'Gln-5' of histone H3 (H3Q5ser) during serotonergic neuron differentiation, thereby facilitating transcription (PubMed:30867594). Acts as a mediator of neurotransmission-independent role of nuclear dopamine in ventral tegmental area (VTA) neurons: catalyzes dopaminylation of 'Gln-5' of histone H3 (H3Q5dop), thereby regulating relapse-related transcriptional plasticity in the reward system (PubMed:32273471). Regulates vein remodeling by mediating serotonylation and subsequent inactivation of ATP2A2/SERCA2 (By similarity). Also acts as a protein deamidase by mediating the side chain deamidation of specific glutamine residues of proteins to glutamate (PubMed:20547769, PubMed:9623982). Catalyzes specific deamidation of protein gliadin, a component of wheat gluten in the diet (PubMed:9623982). May also act as an isopeptidase cleaving the previously formed cross-links (PubMed:26250429, PubMed:27131890). Also able to participate in signaling pathways independently of its acyltransferase activity: acts as a signal transducer in alpha-1 adrenergic receptor-mediated stimulation of phospholipase C-delta (PLCD) activity and is required for coupling alpha-1 adrenergic agonists to the stimulation of phosphoinositide lipid metabolism (PubMed:8943303) |
| Catalytic activity L-glutaminyl-[protein] + L-lysyl-[protein] = [protein]-L-lysyl-N(6)-5-L-glutamyl-[protein] + NH4(+) L-glutaminyl-[protein] + serotonin = 5-serotonyl-L-glutamyl-[protein] + NH4(+) L-glutaminyl-[protein] + dopamine = 5-dopaminyl-L-glutamyl-[protein] + NH4(+) L-glutaminyl-[protein] + histamine = 5-histaminyl-L-glutamyl-[protein] + NH4(+) L-glutaminyl-[protein] + (R)-noradrenaline = 5-(R)-noradrenalinyl-L-glutamyl-[protein] + NH4(+) L-glutaminyl-[protein] + H2O = L-glutamyl-[protein] + NH4(+) |
| Subcellular location Cytoplasm, perinuclear region |
| Structure Homooligomer |
| Post-translational modification Disulfide bond formation inactivates the calcium-dependent acyltransferase activity (PubMed:20547769). Cys-370 can form disulfide bonds with both Cys-230 and Cys-371: formation of a disulfide bond between Cys-230 and Cys-370 facilitates formation of the disulfide between Cys-370 and Cys-371, which promotes inactivation of the acyltransferase activity (PubMed:20547769). May also form interchain disulfids between Cys-230 and Cys-370 (PubMed:25192068). Ca(2+) protects against disulfide bond formation and inactivation (PubMed:20547769) Auto-transglutaminated: Forms covalent cross-links mediated by transglutaminase between Gln-633 and the epsilon-amino group of a lysine residue of itself or HMGB1, forming homopolymers and heteropolymers, respectively S-nitrosylated, leading to inactivation of the acyltransferase activity |
| Keywords 3D-structure, Acetylation, Acyltransferase, Alternative splicing, Calcium, Cell membrane, Chromosome, Cytoplasm, Direct protein sequencing, Disulfide bond, Extracellular matrix, GTP-binding, Hydrolase, Isopeptide bond, Membrane, Metal-binding, Mitochondrion, Nucleotide-binding, Nucleus, Phosphoprotein, Protease, Proteomics identification, Reference proteome, S-nitrosylation, Secreted, Transferase |
| Sequence MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG LHKLVVNFESDKLKAVKGFRNVIIGPA |
| UniProt accession: P21980 |
Data
 |
| Immunoblotting: use at 1-5ug/ml. A band of ~80kDa is detected. Detection of TG2 in human erythroctyes with #4432. |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Transglutaminase-2 (TG2) monoclonal antibody (7D2) validated for?
This antibody has been tested and is suitable for Western Blot (WB) and Immunocytochemistry/Immunofluorescence (ICC/IF) applications.
How should I store the lyophilized mouse anti-TG2 antibody to maintain stability?
The lyophilized antibody is stable for at least one year when stored at -20°C to -70°C. Once reconstituted, it should be aliquoted and stored to avoid repeated freeze-thaw cycles.
What is the recommended dilution for using this antibody in immunoblotting?
For immunoblotting, it is recommended to use the antibody at a concentration of 1-5 µg/mL, which typically detects a band of approximately 80 kDa.
What host species was used to generate the anti-Transglutaminase-2 (TG2) monoclonal antibody 7D2?
The antibody was generated in mouse and is of the IgG3 isotype.
What is the immunogen used for producing this mouse anti-TG2 monoclonal antibody?
The immunogen is purified Transglutaminase-2 (TG2) protein derived from guinea pig liver, accession number P21980.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.