| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Thyroid Peroxidase |
| available sizes | 100 µg |
mouse anti-Thyroid Peroxidase monoclonal antibody (6H7) 3988
$314.00
Antibody summary
- Mouse monoclonal to Thyroid Peroxidase
- Suitable for: ELISA,AP
- Isotype: IgG1
- 100 µg
mouse anti-Thyroid Peroxidase monoclonal antibody (6H7) 3988
| antibody |
|---|
| Tested applications ELISA |
| Recommended dilutions These antibodies may be used in immunoassays to detect/quantitate thyroid peroxidase. They may also be used for immunoaffinity purification of thyroid peroxidase. |
| Immunogen Purified human thyroid peroxidase. The two clones recognize different epitopes; they do not compete with one another in binding to thyroid peroxidase. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions These antibodies are stable for at least one (1) year at -20°C to -70°C. Store product in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS containing 0.1% NaN3 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens TPO Thyroid peroxidase |
| Protein names Thyroid peroxidase |
| Gene names TPO |
| Protein family Belongs to the peroxidase family. XPO subfamily |
| Function Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4) |
| Catalytic activity 2 iodide + H2O2 + 2 H(+) = diiodine + 2 H2O [thyroglobulin]-L-tyrosine + iodide + H2O2 + H(+) = [thyroglobulin]-3-iodo-L-tyrosine + 2 H2O [thyroglobulin]-3-iodo-L-tyrosine + iodide + H2O2 + H(+) = [thyroglobulin]-3,5-diiodo-L-tyrosine + 2 H2O 2 [thyroglobulin]-3,5-diiodo-L-tyrosine + H2O2 = [thyroglobulin]-L-thyroxine + [thyroglobulin]-dehydroalanine + 2 H2O [thyroglobulin]-3-iodo-L-tyrosine + [thyroglobulin]-3,5-diiodo-L-tyrosine + H2O2 = [thyroglobulin]-3,3',5-triiodo-L-thyronine + [thyroglobulin]-dehydroalanine + 2 H2O |
| Subcellular location Cell surface |
| Structure Interacts with DUOX1, DUOX2 and CYBA |
| Post-translational modification Glycosylated Heme is covalently bound through a H(2)O(2)-dependent autocatalytic process. Heme insertion is important for the delivery of protein at the cell surface Cleaved in its N-terminal part |
| Involvement in disease Thyroid dyshormonogenesis 2A A disorder due to defective conversion of accumulated iodide to organically bound iodine. The iodide organification defect can be partial or complete. |
| Keywords Alternative splicing, Calcium, Congenital hypothyroidism, Disease variant, Disulfide bond, EGF-like domain, Glycoprotein, Heme, Hydrogen peroxide, Iron, Membrane, Metal-binding, Oxidoreductase, Peroxidase, Proteomics identification, Reference proteome, Signal, Sushi, Thyroid hormones biosynthesis, Transmembrane, Transmembrane helix |
| Sequence MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQ MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFES CDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD SGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL |
| UniProt accession: P07202 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Thyroid Peroxidase monoclonal antibody (6H7) been validated for?
This antibody has been tested and is suitable for ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blot (WB) applications.
How should the mouse anti-Thyroid Peroxidase monoclonal antibody (6H7) be stored to maintain stability?
The antibody is stable for at least one year when stored at temperatures between -20°C and -70°C. It is recommended to store the product in appropriate aliquots to avoid multiple freeze-thaw cycles.
What is the immunogen used to generate the mouse anti-Thyroid Peroxidase monoclonal antibody (6H7)?
The immunogen used is purified human thyroid peroxidase. The 6H7 clone recognizes a specific epitope distinct from other clones and does not compete with them for binding.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.