| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SRC-1 |
| available sizes | 100 µg |
mouse anti-SRC-1 monoclonal antibody (H4) 5818
$503.00
Antibody summary
- Mouse monoclonal to SRC-1
- Suitable for: WB,IP,ChIP
- Isotype: IgG1
- 100 µg
mouse anti-SRC-1 monoclonal antibody (H4) 5818
| target relevance |
|---|
| Homo sapiens NCOA1 Nuclear receptor coactivator 1 |
| Protein names Nuclear receptor coactivator 1 |
| Alternative names Class E basic helix-loop-helix protein 74, Protein Hin-2, RIP160, Renal carcinoma antigen NY-REN-52, Steroid receptor coactivator 1 |
| Gene names NCOA1 |
| Protein family Belongs to the SRC/p160 nuclear receptor coactivator family |
| Function Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3 |
| Catalytic activity L-lysyl-[protein] + acetyl-CoA = N(6)-acetyl-L-lysyl-[protein] + CoA + H(+) |
| Subcellular location Nucleus |
| Structure Interacts with PPARA; the interaction is direct (PubMed:11698662). Interacts with PPARG; the interaction is direct (PubMed:11698662, PubMed:9744270). Interacts with ESRRG; the interaction is direct (PubMed:11864604). Interacts with STAT5A (via FDL motif) (PubMed:12954634). Interacts with STAT5B (via FDL motif) (PubMed:12954634). Interacts with STAT6 (via LXXLL motif) (PubMed:12138096). Interacts (via LXXLL 1, 2 and 3 motifs) with RORC (via AF-2 motif) (By similarity). Interacts with ASXL1 (PubMed:16606617). Interacts with the methyltransferase CARM1 (By similarity). Interacts with COPS5 (PubMed:10722692). Interacts with the histone acetyltransferase CREBBP (By similarity). Interacts with DDX5 (PubMed:11250900). Interacts with the histone acetyltransferase EP300 (By similarity). Interacts with ESR1 (PubMed:7481822). Interacts with GCCR (PubMed:7481822). Interacts with the basal transcription factor GTF2B (PubMed:8754792). Interacts with NCOA6 (PubMed:10567404). Interacts with NCOA2 (PubMed:10594042). Interacts with NR3C1 (PubMed:12917342). Interacts with NR4A1/Nur77 (PubMed:18690216). Interacts with NR4A3 (By similarity). Interacts with PCAF (PubMed:9296499). Interacts with PGR (PubMed:7481822). Interacts with PRMT2 (PubMed:12039952). Interacts with PRMT6 (PubMed:20047962). Interacts with PSMB9 (PubMed:16957778). Interacts with RXRA, the interaction is ligand-dependent (PubMed:19786558, PubMed:7481822). Interacts with STAT3 following IL-6 stimulation (PubMed:11773079). Interacts with TRA (PubMed:7481822). Interacts with TRIP4 (PubMed:25219498). Interacts with TTLL5/STAMP (PubMed:17116691). Interacts with UBE2L3; they functionally interact to regulate progesterone receptor transcriptional activity (PubMed:15367689). Interacts with VDR (PubMed:28698609) |
| Post-translational modification Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites |
| Keywords 3D-structure, Acetylation, Activator, Acyltransferase, Alternative splicing, Chromosomal rearrangement, Isopeptide bond, Methylation, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Repeat, Transcription, Transcription regulation, Transferase, Ubl conjugation |
| Sequence MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT E |
| UniProt accession: Q15788 |
Data
![]() |
| Mouse tissue (50 µg) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] (5818) diluted at 1:2000. |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-SRC-1 monoclonal antibody (H4) been validated for?
This antibody has been tested and is suitable for Western blotting (WB), immunoprecipitation (IP), and chromatin immunoprecipitation (ChIP) applications. Recommended dilutions for immunoblotting and immunoprecipitation range from 0.5 to 2 µg/mL.
How should the mouse anti-SRC-1 monoclonal antibody (H4) be stored to maintain stability?
The antibody should be stored at -20°C, where it remains stable for at least one year. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.









Reviews
There are no reviews yet.