Immunohistochemistry (IHC) : Human skin stained with anti-SOX-2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of keratinocytes..

mouse anti-SOX-2 monoclonal antibody (ZM57) 6367

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to SOX-2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Normal brain tissue and astrocytoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6367parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, SOX-2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-SOX-2 monoclonal antibody ZM57 6367

antibody
Database link: human P48431
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal brain tissue and astrocytoma
Immunogen Recombinant human SOX2 protein fragment (around aa176-305)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens SOX2 Transcription factor SOX-2
Protein names Transcription factor SOX-2
Gene names SOX2
Function Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206 (By similarity). Binds to the proximal enhancer region of NANOG (By similarity). Critical for early embryogenesis and for embryonic stem cell pluripotency (PubMed:18035408). Downstream SRRT target that mediates the promotion of neural stem cell self-renewal (By similarity). Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation (By similarity). May function as a switch in neuronal development (By similarity)
Subcellular location Nucleus speckle, Cytoplasm, Nucleus
Structure Interacts with ZSCAN10 (By similarity). Interacts with SOX3 and FGFR1 (By similarity). Interacts with GLIS1 (PubMed:21654807). Interacts with POU5F1; binds synergistically with POU5F1 to DNA (By similarity). Interacts with DDX56 (By similarity). Interacts with L3MBTL3 and DCAF5; the interaction requires methylation at Lys-42 and is necessary to target SOX2 for ubiquitination by the CRL4-DCAF5 E3 ubiquitin ligase complex (PubMed:30442713). Interacts with RCOR1/CoREST (By similarity) (PubMed:30442713). Interacts with PHF20L1; the interaction requires methylation at Lys-42 and Lys-117 and protects SOX2 from degradation (PubMed:29358331). Interacts with TRIM26; this interaction prevents ubiquitination by WWP2 (PubMed:34732716)
Post-translational modification Sumoylation inhibits binding on DNA and negatively regulates the FGF4 transactivation Methylation at Lys-42 and Lys-117 is necessary for the regulation of SOX2 proteasomal degradation Ubiquitinated by WWP2, leading to proteasomal degradation
Involvement in disease Microphthalmia, syndromic, 3 A disease characterized by the rare association of malformations including uni- or bilateral anophthalmia or microphthalmia, and esophageal atresia with trachoesophageal fistula. Microphthalmia is a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities.
Keywords 3D-structure, Activator, Cytoplasm, Developmental protein, Disease variant, DNA-binding, Isopeptide bond, Methylation, Microphthalmia, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMA QENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLM KKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGY PQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSM GSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQS GPVPGTAINGTLPLSHM
UniProt accession: P48431

Data

Human skin stained with anti-SOX-2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of keratinocytes..

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-SOX-2 monoclonal antibody (ZM57) 6367 react with?

This antibody specifically reacts with human SOX-2 protein.

For which application is the mouse anti-SOX-2 monoclonal antibody (ZM57) validated?

It is suitable and validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the mouse anti-SOX-2 monoclonal antibody (ZM57)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding repeated freeze/thaw cycles.

What form and sizes are available for the mouse anti-SOX-2 monoclonal antibody (ZM57) 6367?

The antibody is available in liquid form as concentrated solutions of 0.1 mL, 0.5 mL, and 1.0 mL, as well as a 7 mL prediluted format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.