Skip to content

mouse anti-S-100 monoclonal antibody (8B10) 8253

$338.00

Antibody summary

  • Mouse monoclonal to S-100
  • Suitable for: WB,ELISA,AP
  • Isotype: IgG1
  • 100 µg
SKU: 8253parent Category: Tags: ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

S100α/β

available sizes

100 µg

mouse anti-S-100 monoclonal antibody (8B10) 8253

antibody
Tested applications
WB,ELISA
Recommended dilutions
These antibodies may be used in ELISA and Western blot (human brain): 56203, 56204, and 56206 may be used to affinity-purify S-100.Recommended pairs for sandwich ELISA: Capture Detect 56203 56204 56206 56204
Immunogen
Purified S-100 protein from human brain.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
These antibodies are stable for at least one (1) year at -20°C to -70°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4, 0.09% NaN3
Purity
protein affinity purification
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG1 - Isotype Control
target relevance
Homo sapiens S100A1
Protein S100-A1
Protein names
Protein S100-A1
Alternative names
S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1
Gene names
S100A1
Protein family
Belongs to the S-100 family
Function
Small calcium binding protein that plays important roles in several biological processes such as Ca(2+) homeostasis, chondrocyte biology and cardiomyocyte regulation (PubMed:12804600). In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers conformational changes (PubMed:23351007). These changes allow interactions with specific target proteins and modulate their activity (PubMed:22399290). Regulates a network in cardiomyocytes controlling sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function through interaction with the ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2 and mitochondrial F1-ATPase (PubMed:12804600). Facilitates diastolic Ca(2+) dissociation and myofilament mechanics in order to improve relaxation during diastole (PubMed:11717446)
Subcellular location
Cytoplasm, Sarcoplasmic reticulum, Mitochondrion
Structure
Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain (PubMed:21296671). Also forms heterodimers with S100P (PubMed:15171681). Interacts with AGER (By similarity). Interacts with CAPZA1 (By similarity). Interacts with FKBP4 (PubMed:20188096). Interacts with RYR1 and RYR2 (PubMed:18650434). Interacts with CACYBP in a calcium-dependent manner (PubMed:12042313). Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity (PubMed:22399290). Interacts with ATP2A2 and PLN in a Ca(2+)-dependent manner (PubMed:12804600). Interacts with mitochondrial F1-ATPase subunits ATP5F1A and ATP5F1B; these interactions increase F1-ATPase activity (By similarity)
Post-translational modification
Glutathionylated; glutathionylation increases affinity to calcium about 10-fold
Keywords
3D-structure, Calcium, Cytoplasm, Glutathionylation, Metal-binding, Mitochondrion, Proteomics identification, Reference proteome, Repeat, S-nitrosylation, Sarcoplasmic reticulum
Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
UniProt accession: P23297

Data

benchmark-antibodies_anti-s100alpha-beta_antibody_8253_1.jpg
20% PAGE w/ 2mM EGTA, 1 µg Antigen.

FAQ & Publications

Frequently Asked Questions
What applications is the mouse anti-S-100 monoclonal antibody (8B10) validated for?
This antibody is tested and suitable for Western blot (WB), ELISA, and alkaline phosphatase (AP) applications, with additional compatibility for immunocytochemistry/immunofluorescence (ICC/IF).
How should the mouse anti-S-100 monoclonal antibody (8B10) be stored to maintain stability?
The antibody should be stored frozen at temperatures between -20°C and -70°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of this anti-S-100 antibody?
The antibody is a mouse monoclonal antibody of the IgG1 isotype, ensuring specificity and consistency in experimental use.
Which protein isoforms does the mouse anti-S-100 monoclonal antibody (8B10) recognize?
This antibody reacts with S100α and S100β isoforms of the S-100 protein, which are part of the S-100 family of calcium-binding proteins.
What is the concentration and format of the antibody provided?
The antibody is supplied as a liquid solution at a concentration of 1 mg/mL, with a total amount of 100 µg per vial.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.