| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | S100α/β |
| available sizes | 100 µg |
mouse anti-S-100 monoclonal antibody (4B3) 5838
$338.00
Antibody summary
- Mouse monoclonal to S-100
- Suitable for: WB,ELISA,AP
- Isotype: IgG2a
- 100 µg
mouse anti-S-100 monoclonal antibody (4B3) 5838
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions These antibodies may be used in ELISA and Western blot (human brain): 56203, 56204, and 56206 may be used to affinity-purify S-100.Recommended pairs for sandwich ELISA: Capture Detect 56203 56204 56206 56204 |
| Immunogen Purified S-100 protein from human brain. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions These antibodies are stable for at least one (1) year at -20°C to -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4, 0.09% NaN3 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens S100A1 Protein S100-A1 |
| Protein names Protein S100-A1 |
| Alternative names S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1 |
| Gene names S100A1 |
| Protein family Belongs to the S-100 family |
| Function Small calcium binding protein that plays important roles in several biological processes such as Ca(2+) homeostasis, chondrocyte biology and cardiomyocyte regulation (PubMed:12804600). In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers conformational changes (PubMed:23351007). These changes allow interactions with specific target proteins and modulate their activity (PubMed:22399290). Regulates a network in cardiomyocytes controlling sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function through interaction with the ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2 and mitochondrial F1-ATPase (PubMed:12804600). Facilitates diastolic Ca(2+) dissociation and myofilament mechanics in order to improve relaxation during diastole (PubMed:11717446) |
| Subcellular location Cytoplasm, Sarcoplasmic reticulum, Mitochondrion |
| Structure Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain (PubMed:21296671). Also forms heterodimers with S100P (PubMed:15171681). Interacts with AGER (By similarity). Interacts with CAPZA1 (By similarity). Interacts with FKBP4 (PubMed:20188096). Interacts with RYR1 and RYR2 (PubMed:18650434). Interacts with CACYBP in a calcium-dependent manner (PubMed:12042313). Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity (PubMed:22399290). Interacts with ATP2A2 and PLN in a Ca(2+)-dependent manner (PubMed:12804600). Interacts with mitochondrial F1-ATPase subunits ATP5F1A and ATP5F1B; these interactions increase F1-ATPase activity (By similarity) |
| Post-translational modification Glutathionylated; glutathionylation increases affinity to calcium about 10-fold |
| Keywords 3D-structure, Calcium, Cytoplasm, Glutathionylation, Metal-binding, Mitochondrion, Proteomics identification, Reference proteome, Repeat, S-nitrosylation, Sarcoplasmic reticulum |
| Sequence MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
| UniProt accession: P23297 |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-S-100 monoclonal antibody (4B3) 5838 validated for?
This antibody is tested and suitable for use in Western blot (WB), ELISA, and affinity purification (AP). It is also applicable in immunocytochemistry and immunofluorescence (ICC/IF).
How should the mouse anti-S-100 monoclonal antibody (4B3) 5838 be stored to maintain stability?
The antibody should be stored at temperatures between -20°C to -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.









Reviews
There are no reviews yet.