Immunohistochemistry (IHC) : Human melanoma stained with anti-S-100 antibody using peroxidase0conjugate and DAB chromogen. Note intense nuclear and cytoplasmic staining of melanoma cells.

mouse anti-S100 monoclonal antibody (4C4.9) 6357

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to S-100
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Melanoma
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6357parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, S100

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-S-100 monoclonal antibody 4C4.9 6357

antibody
Database link: human P04271
Tested applications IHC
Recommended dilutions Concentrated 1:150-300
Application Notes Positive control: Melanoma
Immunogen Purified bovine brain S100 p
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens S100B Protein S100-B
Protein names Protein S100-B
Alternative names S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B
Gene names S100B
Protein family Belongs to the S-100 family
Function Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed:20950652, PubMed:6487634). Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer (PubMed:20950652, PubMed:6487634). Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites (By similarity). Acts as a neurotrophic factor that promotes astrocytosis and axonal proliferation (By similarity). Involved in innervation of thermogenic adipose tissue by acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation of adipose tissue (By similarity). Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase (By similarity). Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization (PubMed:20351179). May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (PubMed:22399290)
Subcellular location Cytoplasm, Nucleus, Secreted
Structure Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain (PubMed:12480931, PubMed:20950652). The S100B dimer binds two molecules of STK38 (By similarity). Interacts with CACYBP in a calcium-dependent manner (By similarity). Interacts with ATAD3A; this interaction probably occurs in the cytosol prior to ATAD3A mitochondrial targeting (PubMed:20351179). Interacts with S100A6 (PubMed:9925766). The S100B dimer interacts with two molecules of CAPZA1 (PubMed:12480931). Interacts with AGER (PubMed:20943659). Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity (PubMed:22399290). Interacts with TPPP; this interaction inhibits TPPP dimerization (PubMed:33831707). Interacts with isoform CLSTN3beta of CLSTN3; interaction promotes secretion (By similarity)
Keywords 3D-structure, Acetylation, Calcium, Cell adhesion, Cytoplasm, Direct protein sequencing, Metal-binding, Nucleus, Proteomics identification, Reference proteome, Repeat, Secreted, Zinc
Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
UniProt accession: P04271

Data

Human melanoma stained with anti-S-100 antibody using peroxidase0conjugate and DAB chromogen. Note intense nuclear and cytoplasmic staining of melanoma cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-S100 monoclonal antibody (4C4.9) specifically react with?

This antibody is reactive with human species.

What are the recommended storage conditions for the mouse anti-S100 monoclonal antibody (4C4.9) to ensure stability?

Store the antibody at 2-8°C for short term use and at -20°C for longer term storage, while avoiding freeze/thaw cycles to maintain stability.

For immunohistochemistry applications using formalin-fixed, paraffin-embedded tissues, what dilution range is suggested for the concentrated form of this antibody?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:150 and 1:300.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.