| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2b |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Replication Factor C (p37) |
| available sizes | 100 µg |
mouse anti-Replication Factor C p37 monoclonal antibody (1320) 5771
$503.00
Antibody summary
- Mouse monoclonal to Replication Factor C p37
- Suitable for: WB,ICC/IF
- Isotype: IgG2b
- 100 µg
mouse anti-Replication Factor C p37 monoclonal antibody (1320) 5771
| antibody |
|---|
| Tested applications WB,ICC/IF |
| Recommended dilutions Immunoblotting: use at 1:2,000 dilution. A band of 37 kD is detected. Positive controls: HeLa cell lysate. |
| Immunogen Recombinant protein corresponding to the p37 subunit of human Replication Factor C expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2b |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2b - Isotype Control |
| target relevance |
|---|
| Homo sapiens RFC2 Replication factor C subunit 2 |
| Protein names Replication factor C subunit 2 |
| Alternative names Activator 1 40 kDa subunit, Activator 1 subunit 2, Replication factor C 40 kDa subunit |
| Gene names RFC2 |
| Protein family Belongs to the activator 1 small subunits family |
| Function Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA (PubMed:9488738). This subunit binds ATP (By similarity) |
| Subcellular location Nucleus |
| Structure Subunit of the RFC complex, an heteropentameric complex consisting of a large subunit RFC1 and four small subunits RFC2, RFC3, RFC4 and RFC5; the RFC complex interacts with PCNA (PubMed:8999859, PubMed:9488738). Forms an heterotetrameric complex with RFC3, RFC4 and RFC5; this complex has ATPase activity but is not stimulated by PCNA (PubMed:9488738). The heterotetramer of subunits RFC2, RFC3, RFC4 and RFC5 interacts with RAD17 (PubMed:11572977). RFC2 also interacts with PRKAR1A; the complex may be involved in cell survival (PubMed:15655353). Interacts with DDX11 (PubMed:18499658) |
| Keywords 3D-structure, Acetylation, Alternative splicing, ATP-binding, Direct protein sequencing, DNA replication, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Williams-Beuren syndrome |
| Sequence MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRL EVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKI KMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEP IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTF SGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIF RVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS |
| UniProt accession: P35250 |
Data
 |
| Various whole cell extracts (30 µg) were separated by 10% SDS-PAGE, and the membrane was blotted with p37 antibody [1320] (5771) diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody. |
 |
| Immunofluorescence analysis of methanol-fixed MCF7, using p37 [1320](5771) antibody at 1:200 dilution. |
FAQ & Publications
Frequently Asked Questions
What applications has the mouse anti-Replication Factor C p37 monoclonal antibody been validated for?
This antibody has been tested and validated for use in Western blotting (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the mouse anti-Replication Factor C p37 antibody be stored to maintain stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution for immunoblotting with this antibody, and what positive control is suggested?
For immunoblotting, a 1:2,000 dilution of the antibody is recommended. HeLa cell lysate is suggested as a positive control for detecting the 37 kD band corresponding to Replication Factor C p37.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.