Skip to content

mouse anti-Rad51 monoclonal antibody (14B4) 8831

$503.00

Antibody summary

  • Mouse monoclonal to Rad51
  • Suitable for: WB,ICC/IF,IHC-P,IP,IHC,PLA
  • Isotype: IgG2b
  • 100 µg
SKU: 8831parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG2b

clonality

monoclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Rad51

available sizes

100 µg

mouse anti-Rad51 monoclonal antibody (14B4) 8831

antibody
Tested applications
WB,IHC,IHC,ICC/IF
Recommended dilutions
Immunoblotting,

Immunoprecipitation: use at 1-5 ug/mL.

Positive control: T24 bladder carcinoma cells and recombinant fusion protein.
Immunogen
GST fusion protein corresponding to full-length Rad51 (aa 1-338) of human Rad51 expressed in E. coli.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze- thaw cycles.
Storage buffer
PBS, pH 7.4
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG2b
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monocolonal IgG2b - Isotype Control
target relevance
Homo sapiens RAD51
DNA repair protein RAD51 homolog 1
Protein names
DNA repair protein RAD51 homolog 1
Alternative names
RAD51 homolog A
Gene names
RAD51
Protein family
Belongs to the RecA family. RAD51 subfamily
Function
Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR) (PubMed:12205100, PubMed:18417535, PubMed:20231364, PubMed:20348101, PubMed:22325354, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658, PubMed:32640219). Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange (PubMed:12205100, PubMed:18417535, PubMed:15226506, PubMed:20231364, PubMed:20348101, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658). Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template (PubMed:12205100, PubMed:18417535, PubMed:20231364, PubMed:20348101, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658, PubMed:38459011). Recruited to resolve stalled replication forks during replication stress (PubMed:27797818, PubMed:31844045). Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR (PubMed:12442171, PubMed:24141787). Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3 (PubMed:20413593). Also involved in interstrand cross-link repair (PubMed:26253028)
Catalytic activity
ATP + H2O = ADP + phosphate + H(+)
Subcellular location
Nucleus, Cytoplasm, Cytoplasm, perinuclear region, Mitochondrion matrix, Chromosome, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Structure
Forms linear homooligomers, giving rise to a RAD51 nucleoprotein filament, which is essential for strand-pairing reactions during DNA recombination (PubMed:12442171). Interacts with RAD54L; the interaction enhances RAD51-mediated homology search and strand invasion (PubMed:9321665, PubMed:10851248, PubMed:12205100, PubMed:29507080). Interacts with RAD54B; the interaction could enhance RAD51-mediated homology search and strand invasion (PubMed:10851248, PubMed:11884632, PubMed:16428451). Interacts with BRCA1 and either directly or indirectly with p53 (By similarity). Interacts with XRCC3 (PubMed:11842113). Interacts with the BCDX2 subcomplex RAD51C:RAD51B. Component of the homologous recombination repair (HR) complex composed of ERCC5/XPG, BRCA2, PALB2, DSS1 and RAD51 (PubMed:26833090). Interacts directly with PALB2 which may serve as a scaffold for a HR complex containing PALB2, BRCA2, RAD51C, RAD51 and XRCC3. Interacts with RAD51AP1 and RAD51AP2. Interacts with CHEK1, and this may require prior phosphorylation of CHEK1. Interacts with the MND1-PSMC3IP heterodimer. Found in a complex, at least composed of BLM, RAD51 and SPIDR; the complex formation is mediated by SPIDR. Interacts with SPIDR; the interaction is direct and recruits RAD51 to DNA damage sites. Interacts with FIGNL1 (via N-terminal one-half region); the interaction is direct. Interacts with RAD51AP1 (via C-terminal region); the interaction is direct. Interacts with NABP2, RPA1, PALB2 and RAD51. Interacts with SWI5/C9orf119, and at lower level with SFR1/MEIR5. Interacts with hyperphosphorylated RPA2; this interaction is necessary for efficient recruitment to chromatin in response to DNA damage. Interacts with SWSAP1; involved in homologous recombination repair. Interacts with PARPBP, BRCA2 and RECQL5; these interactions interfere with the formation of the RAD51-DNA homologous recombination structure. Interacts with POLQ; POLQ acts as an inhibitor of homology-recombination repair (HR) pathway by limiting RAD51 accumulation at resected ends (PubMed:25642963). Interacts with FBH1 (PubMed:23393192). Interacts with POLN (PubMed:19995904). Interacts with RFWD3 (PubMed:28575658). Interacts with the MCM8-MCM9 complex; the interaction recruits RAD51 to DNA damage sites (PubMed:23401855). Component of a multiprotein complex with MEIOB and SPATA22. Interacts with the complex BRME1:HSF2BP:BRCA2 (By similarity). Interacts with HELQ; stimulating HELQ DNA helicase activity and ability to unwing DNA (PubMed:34937945). Interacts with MMS22L; the interaction is direct and promotes recruitment of RAD51 to sites of DNA damage (PubMed:27797818). Interacts with the ATAD5 RFC-like complex (PubMed:31844045). Within the ATAD5 RFC-like complex, interacts with ATAD5 (via N-terminus); the interaction is direct and enhanced under replication stress (PubMed:31844045). Interacts with WDR48; the interaction is enhanced under replication stress (PubMed:31844045). Interacts with DNA helicase ZGRF1; the interaction promotes RAD51 strand exchange activity (PubMed:32640219). Interacts (when phosphorylated) with TOPBP1; interaction takes place following phosphorylation by CK2 and PLK1 and promotes recruitment to DNA damage sites (PubMed:26811421). Interacts with GRB2; this interaction inhibits RAD51 ATPase activity to stabilize RAD51 on stalled replication forks (PubMed:38459011)
Post-translational modification
Ubiquitinated by the SCF(FBH1) E3 ubiquitin ligase complex, regulating RAD51 subcellular location and preventing its association with DNA. Ubiquitinated by RFWD3 in response to DNA damage: ubiquitination leads to degradation by the proteasome, promoting homologous recombination (PubMed:28575658)
Phosphorylation of Thr-309 by CHEK1 may enhance association with chromatin at sites of DNA damage and promote DNA repair by homologous recombination (PubMed:15665856). Phosphorylated at Ser-14 by PLK1, triggering phosphorylation at Thr-13 by CK2, thereby promoting interaction with TOPBP1 and recruitment to DNA damage sites during S-phase (PubMed:22325354, PubMed:26811421). Phosphorylation by ABL1 inhibits function (PubMed:9461559)
Involvement in disease
Breast cancer
A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case.

Mirror movements 2
A disorder characterized by contralateral involuntary movements that mirror voluntary ones. While mirror movements are occasionally found in young children, persistence beyond the age of 10 is abnormal. Mirror movements occur more commonly in the upper extremities.

Fanconi anemia, complementation group R
A disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia. It is associated with cardiac, renal and limb malformations, dermal pigmentary changes, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage) and defective DNA repair.

Keywords
3D-structure, Acetylation, Alternative splicing, ATP-binding, Chromosome, Cytoplasm, Cytoskeleton, Disease variant, DNA damage, DNA recombination, DNA repair, DNA-binding, Fanconi anemia, Hydrolase, Isopeptide bond, Mitochondrion, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
UniProt accession: Q06609

Data

benchmark-antibodies_anti-rad51_antibody_8831_1.jpg
Immunofluorecent staning of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody (8831).
Cells were pre-extracted with CSK buffer before fixation with 4% PFA.
RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus.
Scale bar, 10 mciro-meter.
benchmark-antibodies_anti-rad51_antibody_8831_2.jpg
Mouse anti-RAD51 14B4 antibody (8831) was used in IP assay (immunoprecipitation) using HeLa cell extract prepared with lysis 180 buffer (40 mM Tris-HCl pH8.0, 180 mM NaCl, 1 mMEDTA, 0.5% NP-40).
Rabbit anti-RAD51 antibody was used for subsequent WB detection of immunoprecipated RAD51.
Whole cell extract was used as input.
benchmark-antibodies_anti-rad51_antibody_8831_3.jpg
RAD51 antibody 14B4 (8831) detects RAD51 in nucleus on BT483 xenograft by immunohistochemical analysis.
Sample: Paraffin-embedded BT483 xenograft.
RAD51 antibody 14B4 (88318) dilution: 1:200.
Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
benchmark-antibodies_anti-rad51_antibody_8831_4.jpg
Various whole cell extracts (30 µg) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] (8831) diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
benchmark-antibodies_anti-rad51_antibody_8831_5.jpg
Various whole cell extracts (30 µg) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] (8831) diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
benchmark-antibodies_anti-rad51_antibody_8831_6.jpg
Whole cell extract (30 µg) was separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] (8831) diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
benchmark-antibodies_anti-rad51_antibody_8831_7.jpg
Various whole cell extracts (30 µg) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] (8831) diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
benchmark-antibodies_anti-rad51_antibody_8831_8.jpg
Rad51 antibody [14B4] detects Rad51 protein at nuclear foci by immunofluorescent analysis.
Sample: Mock and treated HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.
Green: Rad51 stained by Rad51 antibody [14B4] (8831) diluted at 1:500.
Blue: Fluoroshield with DAPI.

FAQ & Publications

Frequently Asked Questions
What are the recommended applications for the mouse anti-Rad51 monoclonal antibody (14B4)?
This antibody is suitable for Western Blot (WB), Immunocytochemistry/Immunofluorescence (ICC/IF), Immunohistochemistry on paraffin-embedded sections (IHC-P), Immunoprecipitation (IP), and Proximity Ligation Assay (PLA).
How should the mouse anti-Rad51 monoclonal antibody (14B4) be stored to maintain stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this mouse anti-Rad51 monoclonal antibody?
The immunogen is a GST fusion protein corresponding to the full-length human Rad51 protein (amino acids 1-338) expressed in Escherichia coli.
What is the concentration and form of the supplied mouse anti-Rad51 monoclonal antibody (14B4)?
The antibody is supplied as a liquid at a concentration of 1 mg/mL, with a total amount of 100 µg per vial.
Which secondary antibodies are compatible with this mouse anti-Rad51 monoclonal antibody for detection?
Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific, conjugated to peroxidase, biotin, or FITC. Both standard and cross-absorbed polyclonal antibodies are recommended for use.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.