| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2b |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Rad51 |
| available sizes | 100 µg |
mouse anti-Rad51 monoclonal antibody (14B4) 8831
$503.00
Antibody summary
- Mouse monoclonal to Rad51
- Suitable for: WB,ICC/IF,IHC-P,IP,IHC,PLA
- Isotype: IgG2b
- 100 µg
mouse anti-Rad51 monoclonal antibody (14B4) 8831
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF |
| Recommended dilutions Immunoblotting, Immunoprecipitation: use at 1-5 ug/mL. Positive control: T24 bladder carcinoma cells and recombinant fusion protein. |
| Immunogen GST fusion protein corresponding to full-length Rad51 (aa 1-338) of human Rad51 expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity affinity purified |
| Clonality monoclonal |
| Isotype IgG2b |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2b - Isotype Control |
| target relevance |
|---|
| Homo sapiens RAD51 DNA repair protein RAD51 homolog 1 |
| Protein names DNA repair protein RAD51 homolog 1 |
| Alternative names RAD51 homolog A |
| Gene names RAD51 |
| Protein family Belongs to the RecA family. RAD51 subfamily |
| Function Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR) (PubMed:12205100, PubMed:18417535, PubMed:20231364, PubMed:20348101, PubMed:22325354, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658, PubMed:32640219). Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange (PubMed:12205100, PubMed:18417535, PubMed:15226506, PubMed:20231364, PubMed:20348101, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658). Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template (PubMed:12205100, PubMed:18417535, PubMed:20231364, PubMed:20348101, PubMed:23509288, PubMed:23754376, PubMed:26681308, PubMed:28575658, PubMed:38459011). Recruited to resolve stalled replication forks during replication stress (PubMed:27797818, PubMed:31844045). Part of a PALB2-scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR (PubMed:12442171, PubMed:24141787). Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3 (PubMed:20413593). Also involved in interstrand cross-link repair (PubMed:26253028) |
| Catalytic activity ATP + H2O = ADP + phosphate + H(+) |
| Subcellular location Nucleus, Cytoplasm, Cytoplasm, perinuclear region, Mitochondrion matrix, Chromosome, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome |
| Structure Forms linear homooligomers, giving rise to a RAD51 nucleoprotein filament, which is essential for strand-pairing reactions during DNA recombination (PubMed:12442171). Interacts with RAD54L; the interaction enhances RAD51-mediated homology search and strand invasion (PubMed:9321665, PubMed:10851248, PubMed:12205100, PubMed:29507080). Interacts with RAD54B; the interaction could enhance RAD51-mediated homology search and strand invasion (PubMed:10851248, PubMed:11884632, PubMed:16428451). Interacts with BRCA1 and either directly or indirectly with p53 (By similarity). Interacts with XRCC3 (PubMed:11842113). Interacts with the BCDX2 subcomplex RAD51C:RAD51B. Component of the homologous recombination repair (HR) complex composed of ERCC5/XPG, BRCA2, PALB2, DSS1 and RAD51 (PubMed:26833090). Interacts directly with PALB2 which may serve as a scaffold for a HR complex containing PALB2, BRCA2, RAD51C, RAD51 and XRCC3. Interacts with RAD51AP1 and RAD51AP2. Interacts with CHEK1, and this may require prior phosphorylation of CHEK1. Interacts with the MND1-PSMC3IP heterodimer. Found in a complex, at least composed of BLM, RAD51 and SPIDR; the complex formation is mediated by SPIDR. Interacts with SPIDR; the interaction is direct and recruits RAD51 to DNA damage sites. Interacts with FIGNL1 (via N-terminal one-half region); the interaction is direct. Interacts with RAD51AP1 (via C-terminal region); the interaction is direct. Interacts with NABP2, RPA1, PALB2 and RAD51. Interacts with SWI5/C9orf119, and at lower level with SFR1/MEIR5. Interacts with hyperphosphorylated RPA2; this interaction is necessary for efficient recruitment to chromatin in response to DNA damage. Interacts with SWSAP1; involved in homologous recombination repair. Interacts with PARPBP, BRCA2 and RECQL5; these interactions interfere with the formation of the RAD51-DNA homologous recombination structure. Interacts with POLQ; POLQ acts as an inhibitor of homology-recombination repair (HR) pathway by limiting RAD51 accumulation at resected ends (PubMed:25642963). Interacts with FBH1 (PubMed:23393192). Interacts with POLN (PubMed:19995904). Interacts with RFWD3 (PubMed:28575658). Interacts with the MCM8-MCM9 complex; the interaction recruits RAD51 to DNA damage sites (PubMed:23401855). Component of a multiprotein complex with MEIOB and SPATA22. Interacts with the complex BRME1:HSF2BP:BRCA2 (By similarity). Interacts with HELQ; stimulating HELQ DNA helicase activity and ability to unwing DNA (PubMed:34937945). Interacts with MMS22L; the interaction is direct and promotes recruitment of RAD51 to sites of DNA damage (PubMed:27797818). Interacts with the ATAD5 RFC-like complex (PubMed:31844045). Within the ATAD5 RFC-like complex, interacts with ATAD5 (via N-terminus); the interaction is direct and enhanced under replication stress (PubMed:31844045). Interacts with WDR48; the interaction is enhanced under replication stress (PubMed:31844045). Interacts with DNA helicase ZGRF1; the interaction promotes RAD51 strand exchange activity (PubMed:32640219). Interacts (when phosphorylated) with TOPBP1; interaction takes place following phosphorylation by CK2 and PLK1 and promotes recruitment to DNA damage sites (PubMed:26811421). Interacts with GRB2; this interaction inhibits RAD51 ATPase activity to stabilize RAD51 on stalled replication forks (PubMed:38459011) |
| Post-translational modification Ubiquitinated by the SCF(FBH1) E3 ubiquitin ligase complex, regulating RAD51 subcellular location and preventing its association with DNA. Ubiquitinated by RFWD3 in response to DNA damage: ubiquitination leads to degradation by the proteasome, promoting homologous recombination (PubMed:28575658) Phosphorylation of Thr-309 by CHEK1 may enhance association with chromatin at sites of DNA damage and promote DNA repair by homologous recombination (PubMed:15665856). Phosphorylated at Ser-14 by PLK1, triggering phosphorylation at Thr-13 by CK2, thereby promoting interaction with TOPBP1 and recruitment to DNA damage sites during S-phase (PubMed:22325354, PubMed:26811421). Phosphorylation by ABL1 inhibits function (PubMed:9461559) |
| Involvement in disease Breast cancer A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Mirror movements 2 A disorder characterized by contralateral involuntary movements that mirror voluntary ones. While mirror movements are occasionally found in young children, persistence beyond the age of 10 is abnormal. Mirror movements occur more commonly in the upper extremities. Fanconi anemia, complementation group R A disorder affecting all bone marrow elements and resulting in anemia, leukopenia and thrombopenia. It is associated with cardiac, renal and limb malformations, dermal pigmentary changes, and a predisposition to the development of malignancies. At the cellular level it is associated with hypersensitivity to DNA-damaging agents, chromosomal instability (increased chromosome breakage) and defective DNA repair. |
| Keywords 3D-structure, Acetylation, Alternative splicing, ATP-binding, Chromosome, Cytoplasm, Cytoskeleton, Disease variant, DNA damage, DNA recombination, DNA repair, DNA-binding, Fanconi anemia, Hydrolase, Isopeptide bond, Mitochondrion, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation |
| Sequence MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD |
| UniProt accession: Q06609 |
Data
FAQ & Publications
Frequently Asked Questions
What are the recommended applications for the mouse anti-Rad51 monoclonal antibody (14B4)?
This antibody is suitable for Western Blot (WB), Immunocytochemistry/Immunofluorescence (ICC/IF), Immunohistochemistry on paraffin-embedded sections (IHC-P), Immunoprecipitation (IP), and Proximity Ligation Assay (PLA).
How should the mouse anti-Rad51 monoclonal antibody (14B4) be stored to maintain stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this mouse anti-Rad51 monoclonal antibody?
The immunogen is a GST fusion protein corresponding to the full-length human Rad51 protein (amino acids 1-338) expressed in Escherichia coli.
What is the concentration and form of the supplied mouse anti-Rad51 monoclonal antibody (14B4)?
The antibody is supplied as a liquid at a concentration of 1 mg/mL, with a total amount of 100 µg per vial.
Which secondary antibodies are compatible with this mouse anti-Rad51 monoclonal antibody for detection?
Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific, conjugated to peroxidase, biotin, or FITC. Both standard and cross-absorbed polyclonal antibodies are recommended for use.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.























Reviews
There are no reviews yet.