| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG2a |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Progesterone Receptor |
| available sizes | 100 µg |
mouse anti-Progesterone Receptor monoclonal antibody (4D8) 5585
$503.00
Antibody summary
- Mouse monoclonal to Progesterone Receptor
- Suitable for: WB
- Isotype: IgG2a
- 100 µg
mouse anti-Progesterone Receptor monoclonal antibody (4D8) 5585
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1-5 ug/ml. Positive controls: MCF7 cells or recombinant protein. |
| Immunogen 6-His fusion protein containing the region encoding aa 1-101 of human progesterone receptor expressed in E. coli. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity protein affinity purification |
| Clonality monoclonal |
| Isotype IgG2a |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG2a - Isotype Control |
| target relevance |
|---|
| Homo sapiens PGR Progesterone receptor |
| Protein names Progesterone receptor |
| Alternative names Nuclear receptor subfamily 3 group C member 3 |
| Gene names PGR |
| Protein family Belongs to the nuclear hormone receptor family. NR3 subfamily |
| Function The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcriptional activator or repressor |
| Subcellular location Mitochondrion outer membrane |
| Structure Interacts with SMARD1 and UNC45A. Interacts with CUEDC2; the interaction promotes ubiquitination, decreases sumoylation, and represses transcriptional activity. Interacts with PIAS3; the interaction promotes sumoylation of PR in a hormone-dependent manner, inhibits DNA-binding, and alters nuclear export. Interacts with SP1; the interaction requires ligand-induced phosphorylation on Ser-345 by ERK1/2 MAPK. Interacts with PRMT2. Isoform A interacts with NCOR2. Isoform B (but not isoform A) interacts with NCOA2 and NCOA1. Isoform B (but not isoform A) interacts with KLF9. Interacts with GTF2B (PubMed:1517211) |
| Post-translational modification Phosphorylated on multiple serine sites. Several of these sites are hormone-dependent. Phosphorylation on Ser-294 occurs preferentially on isoform B, is highly hormone-dependent and modulates ubiquitination and sumoylation on Lys-388. Phosphorylation on Ser-102 and Ser-345 also requires induction by hormone. Basal phosphorylation on Ser-81, Ser-162, Ser-190 and Ser-400 is increased in response to progesterone and can be phosphorylated in vitro by the CDK2-A1 complex. Increased levels of phosphorylation on Ser-400 also in the presence of EGF, heregulin, IGF, PMA and FBS. Phosphorylation at this site by CDK2 is ligand-independent, and increases nuclear translocation and transcriptional activity. Phosphorylation at Ser-162 and Ser-294, but not at Ser-190, is impaired during the G(2)/M phase of the cell cycle. Phosphorylation on Ser-345 by ERK1/2 MAPK is required for interaction with SP1 Sumoylation is hormone-dependent and represses transcriptional activity. Sumoylation on all three sites is enhanced by PIAS3. Desumoylated by SENP1. Sumoylation on Lys-388, the main site of sumoylation, is repressed by ubiquitination on the same site, and modulated by phosphorylation at Ser-294 Ubiquitination is hormone-dependent and represses sumoylation on the same site (PubMed:10628747, PubMed:10655479, PubMed:15798179, PubMed:17173941, PubMed:17717077, PubMed:18202149, PubMed:8702648). Promoted by MAPK-mediated phosphorylation on Ser-294 (PubMed:10628747, PubMed:10655479, PubMed:15798179, PubMed:17173941, PubMed:17717077, PubMed:18202149, PubMed:8702648). Ubiquitinated by UBR5, leading to its degradation: UBR5 specifically recognizes and binds ligand-bound PGR when it is not associated with coactivators (NCOAs) (PubMed:37478846). In presence of NCOAs, the UBR5-degron is not accessible, preventing its ubiquitination and degradation (PubMed:37478846) Palmitoylated by ZDHHC7 and ZDHHC21. Palmitoylation is required for plasma membrane targeting and for rapid intracellular signaling via ERK and AKT kinases and cAMP generation |
| Keywords 3D-structure, Alternative promoter usage, Alternative splicing, Cytoplasm, Direct protein sequencing, DNA-binding, Isopeptide bond, Lipid-binding, Lipoprotein, Membrane, Metal-binding, Mitochondrion, Mitochondrion outer membrane, Nucleus, Palmitate, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Steroid-binding, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger |
| Sequence MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK |
| UniProt accession: P06401 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Progesterone Receptor monoclonal antibody (4D8) suitable for?
This antibody is suitable for Western Blot (WB) and Immunocytochemistry/Immunofluorescence (ICC/IF) applications.
How should the mouse anti-Progesterone Receptor monoclonal antibody (4D8) be stored to maintain stability?
The antibody should be stored at -70°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and isotype of this monoclonal antibody?
The antibody is a mouse monoclonal antibody with an IgG2a isotype.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.