Immunohistochemistry (IHC) : Human placenta stained with anti-PLAP antibody using peroxidase-conjugate and DAB chromogen. Note the membrane staining of trophoblasts..

mouse anti-PLAP monoclonal antibody (ZM161) 6337

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to PLAP
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Placenta
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6337parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gynecological Pathology, PLAP

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-PLAP monoclonal antibody ZM161 6337

antibody
Database link: human P05187
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Placenta
Immunogen Recombinant full-length human ALPP protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens ALPP Alkaline phosphatase, placental type
Protein names Alkaline phosphatase, placental type
Alternative names Alkaline phosphatase Regan isozyme, Placental alkaline phosphatase 1
Gene names ALPP
Protein family Belongs to the alkaline phosphatase family
Function Alkaline phosphatase that can hydrolyze various phosphate compounds
Catalytic activity a phosphate monoester + H2O = an alcohol + phosphate
Subcellular location Cell membrane
Structure Homodimer
Keywords 3D-structure, Calcium, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, GPI-anchor, Hydrolase, Lipoprotein, Magnesium, Membrane, Metal-binding, Proteomics identification, Reference proteome, Signal, Transmembrane, Transmembrane helix, Zinc
Sequence MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP
UniProt accession: P05187

Data

Human placenta stained with anti-PLAP antibody using peroxidase-conjugate and DAB chromogen. Note the membrane staining of trophoblasts..

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-PLAP monoclonal antibody (ZM161) specifically react with?

This antibody is reactive with human tissues, making it suitable for studies involving human samples.

How should the mouse anti-PLAP monoclonal antibody (ZM161) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain its integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.