| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG1 |
| clonality | monoclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Osteonectin/SPARC |
| available sizes | 100 µg |
mouse anti-Osteonectin (SPARC) monoclonal antibody (ON1-1) 2839
$509.00
Antibody summary
- Mouse monoclonal to Osteonectin (SPARC)
- Suitable for: WB,IHC,FACS
- Isotype: IgG1
- 100 µg
mouse anti-Osteonectin (SPARC) monoclonal antibody (ON1-1) 2839
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions ELISA: 1-10ug/ml with immobilized antigen Western Blot: 1-10ug/ml, reducing and non-reducing conditions. Immunohistochemistry: 1-10ug/ml, paraffin-embedded and frozen tissue sections. |
| Immunogen Bovine bone osteonectin (SPARC) |
| Size and concentration 100µg and |
| Form lyophilized |
| Storage Instructions This product does not contain preservative. Lyophilized antibody is stable at 4°C for 2 years. Store the reconstituted solution (2. 0mg/ml) in aliquots at -20°C for one year or at 4° |
| Storage buffer 10 mM PBS, pH 7.4, 1% BSA, lyophilized |
| Purity immunogen affinity purification |
| Clonality monoclonal |
| Isotype IgG1 |
| Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721 |
| Isotype control Mouse monocolonal IgG1 - Isotype Control |
| target relevance |
|---|
| Homo sapiens SPARC SPARC |
| Protein names SPARC |
| Alternative names Basement-membrane protein 40, Osteonectin, Secreted protein acidic and rich in cysteine |
| Gene names SPARC |
| Protein family Belongs to the SPARC family |
| Function Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity |
| Subcellular location Secreted, extracellular space, extracellular matrix, basement membrane |
| Involvement in disease Osteogenesis imperfecta 17 An autosomal recessive form of osteogenesis imperfecta, a disorder of bone formation characterized by low bone mass, bone fragility and susceptibility to fractures after minimal trauma. Disease severity ranges from very mild forms without fractures to intrauterine fractures and perinatal lethality. Extraskeletal manifestations, which affect a variable number of patients, are dentinogenesis imperfecta, hearing loss, and blue sclerae. |
| Keywords 3D-structure, Basement membrane, Calcium, Copper, Direct protein sequencing, Disease variant, Disulfide bond, Extracellular matrix, Glycoprotein, Metal-binding, Osteogenesis imperfecta, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD LVI |
| UniProt accession: P09486 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the mouse anti-Osteonectin (SPARC) monoclonal antibody (ON1-1) validated for?
This antibody is suitable and tested for Western Blot (WB), Immunohistochemistry (IHC) on paraffin-embedded and frozen tissue sections, and Fluorescence-Activated Cell Sorting (FACS). Recommended dilutions range from 1-10 µg/ml depending on the assay.
How should the mouse anti-Osteonectin (SPARC) monoclonal antibody be stored to maintain stability?
The lyophilized antibody is stable at 4°C for up to 2 years. Once reconstituted to 2.0 mg/ml, aliquots should be stored at -20°C for up to one year or at 4°C for short-term use. Note that this product does not contain preservatives.
What is the immunogen used for generating this mouse monoclonal antibody against Osteonectin (SPARC)?
The antibody was raised against bovine bone osteonectin (SPARC), ensuring specificity for the target protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.